• Gene id: 117246

Gene Summary

• Gene Symbol: FTSJ3   Gene   UCSC   Ensembl
• Aliases: EPCS3, SPB1
• Gene name: FtsJ RNA 2'-O-methyltransferase 3
• Alternate names: pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3, 2'-O-ribose RNA methyltransferase SPB1 homolog, FtsJ RNA methyltransferase homolog 3, FtsJ homolog 3, SPB1 RNA methyltransferase homolog, pre-rRNA processing protein FTSJ3, protein ftsJ homolog 3, putative rRNA m,
• Gene location: 17q23.3 (63827662: 63819432)     Exons: 22     NC_000017.11
• Gene summary(Entrez): Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein
• OMIM: 602246

Protein Summary

• Protein general information: Q8IY81  
  • Name: pre rRNA 2' O ribose RNA methyltransferase FTSJ3 (EC 2.1.1. ) (Protein ftsJ homolog 3) (Putative rRNA methyltransferase 3)
  • Length: 847  
  • Mass: 96558
• Sequence:

  MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQVAAKFMPVSSLIVGV
  DLVPIKPLPNVVTLQQDITTERCRQALRKELKTWKVDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLAR
  GGSFITKVFRSRDYQPLLWIFQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAK
  TVTELVTKKKPKAEGYAEGDLTLYHRTSVTDFLRAANPVDFLSKASEIMVDDEELAQHPATTEDIRVCCQDIRVL
  GRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDEEDSTAGTTKQPSKEEEEEEEEEQLNQTLAEM
  KAQEVAELKRKKKKLLREQRKQRERVELKMDLPGVSIADEGETGMFSLSTIRGHQLLEEVTQGDMSAADTFLSDL
  PRDDIYVSDVEDDGDDTSLDSDLDPEELAGVRGHQGLRDQKRMRLTEVQDDKEEEEEENPLLVPLEEKAVLQEEQ
  ANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSG
  TEAATGLEGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIA
  SSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKK
  RRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVD
  SRMKKDQRAQQRKEQKKKHKRK

• Structural information:
  • Interpro: IPR015507  IPR012920  IPR024576  IPR002877  IPR029063   IPR028589  
  • STRING: ENSP00000396673
• Other Databases: GeneCards:  FTSJ3  Malacards:  FTSJ3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0001510	RNA methylation	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0016435	rRNA (guanine) methyltransferase activity	IBA	molecular function
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0008173	RNA methyltransferase activity	IBA	molecular function
GO:0008650	rRNA (uridine-2'-O-)-methyltransferase activity	IBA	molecular function
GO:0031167	rRNA methylation	IBA	biological process
GO:0001510	RNA methylation	IDA	biological process
GO:0062105	RNA 2'-O-methyltransferase activity	IDA	molecular function
GO:0001510	RNA methylation	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0008649	rRNA methyltransferase activity	IEA	molecular function
GO:0031167	rRNA methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0006364	rRNA processing	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0030688	preribosome, small subunit precursor	IEA	cellular component
GO:0008649	rRNA methyltransferase activity	IEA	molecular function
GO:0000453	enzyme-directed rRNA 2'-O-methylation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq