• Gene id: 117245

Gene Summary

• Gene Symbol: PLAAT5   Gene   UCSC   Ensembl
• Aliases: HRASLS5, HRLP5, HRSL5, PLAAT-5, RLP1, iNAT
• Gene name: phospholipase A and acyltransferase 5
• Alternate names: phospholipase A and acyltransferase 5, Ca(2+)-independent N-acyltransferase, H-rev107-like protein 5, HRAS like suppressor family member 5, HRAS-like suppressor 5, calcium-independent phosphatidylethanolamine N-acyltransferase, lecithin-retinol acyltransferase ,
• Gene location: 11q12.3 (63491202: 63461403)     Exons: 7     NC_000011.10
• OMIM: 611474

Protein Summary

• Protein general information: Q96KN8  
  • Name: Phospholipase A and acyltransferase 5 (Ca(2+) independent N acyltransferase) (iNAT) (EC 2.3.1. ) (EC 3.1.1.32) (EC 3.1.1.4) (H rev107 like protein 5) (HRAS like suppressor 5) (HRSL5)
  • Length: 279  
  • Mass: 30312
  • Tissue specificity: Highest expression level in testis and pancreas.
• Sequence:

  MGLSPGAEGEYALRLPRIPPPLPKPASRTASTGPKDQPPALRRSAVPHSGLNSISPLELEESVGFAALVQLPAKQ
  PPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFRIGYEHWAIYV
  EDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQ
  YSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA

• Structural information:
  • Interpro: IPR007053  
  • STRING: ENSP00000301790
• Other Databases: GeneCards:  PLAAT5  Malacards:  PLAAT5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008970	phospholipase A1 activity	IBA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IBA	biological process
GO:0016410	N-acyltransferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IDA	biological process
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0016410	N-acyltransferase activity	IDA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0052739	phosphatidylserine 1-acylhydrolase activity	IEA	molecular function
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0052740	1-acyl-2-lysophosphatidylserine acylhydrolase activity	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IDA	biological process
GO:0016410	N-acyltransferase activity	IDA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IEA	biological process
GO:0016410	N-acyltransferase activity	IEA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IEA	biological process
GO:0016410	N-acyltransferase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray