• Gene id: 117195

Gene Summary

• Gene Symbol: MRGPRX3   Gene   UCSC   Ensembl
• Aliases: GPCR, MRGX3, SNSR1, SNSR2
• Gene name: MAS related GPR family member X3
• Alternate names: mas-related G-protein coupled receptor member X3, G protein-coupled receptor MRGX3, G protein-coupled receptor SNSR1, G protein-coupled receptor SNSR2, MAS-related GPR, member X3, mas-related GPCR member X3, sensory neuron-specific G-protein coupled receptor 1/,
• Gene location: 11p15.1 (18120954: 18138487)     Exons: 3     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. The encoded protein may be involved in sensory neuron regulation and in the modulation of pain. [provided by RefSeq, Oct 2009]

Protein Summary

• Protein general information: Q96LB0  
  • Name: Mas related G protein coupled receptor member X3 (Sensory neuron specific G protein coupled receptor 1/2)
  • Length: 322  
  • Mass: 36483
  • Tissue specificity: Uniquely localized in a subset of small dorsal root and trigeminal sensory neurons. {ECO
• Sequence:

  MDSTIPVLGTELTPINGREETPCYKQTLSFTGLTCIVSLVALTGNAVVLWLLGCRMRRNAVSIYILNLVAADFLF
  LSGHIICSPLRLINIRHPISKILSPVMTFPYFIGLSMLSAISTERCLSILWPIWYHCRRPRYLSSVMCVLLWALS
  LLRSILEWMFCDFLFSGANSVWCETSDFITIAWLVFLCVVLCGSSLVLLVRILCGSRKMPLTRLYVTILLTVLVF
  LLCGLPFGIQWALFSRIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPE
  VDEGGGWLPQETLELSGSRLEQ

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR026234  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000379571
• Other Databases: GeneCards:  MRGPRX3  Malacards:  MRGPRX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq