• Gene id: 117145

Gene Summary

• Gene Symbol: THEM4   Gene   UCSC   Ensembl
• Aliases: CTMP
• Gene name: thioesterase superfamily member 4
• Alternate names: acyl-coenzyme A thioesterase THEM4, C-terminal modulator protein, acyl-CoA thioesterase THEM4, carboxyl-terminal modulator protein,
• Gene location: 1q21.3 (151909510: 151870865)     Exons: 7     NC_000001.11
• Gene summary(Entrez): Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory doma
• OMIM: 606388

Protein Summary

• Protein general information: Q5T1C6  
  • Name: Acyl coenzyme A thioesterase THEM4 (Acyl CoA thioesterase THEM4) (EC 3.1.2.2) (Carboxyl terminal modulator protein) (Thioesterase superfamily member 4)
  • Length: 240  
  • Mass: 27130
  • Tissue specificity: Expressed predominantly in skeletal muscle, testis, uterus, brain and kidney. Down-regulated in glioblastoma or glioma compared to non-neoplastic brain due to promoter hypermethylation. {ECO
• Sequence:

  MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKR
  LPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGF
  IHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSE
  ATSLFIKLNPAKSLT

• Structural information:
  • Interpro: IPR029069  IPR006683  
  • PDB: 4AE8 4GAH
  • PDBsum: 4AE8 4GAH
  • DIP: 60764
  • STRING: ENSP00000357804
• Other Databases: GeneCards:  THEM4  Malacards:  THEM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IDA	cellular component
GO:0016290	palmitoyl-CoA hydrolase activity	IDA	molecular function
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0102991	myristoyl-CoA hydrolase activity	IEA	molecular function
GO:0016290	palmitoyl-CoA hydrolase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0051898	negative regulation of protein kinase B signaling	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032587	ruffle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:1902108	regulation of mitochondrial membrane permeability involved in apoptotic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa00062	Fatty acid elongation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881