• Gene id: 117143

Gene Summary

• Gene Symbol: TADA1   Gene   UCSC   Ensembl
• Aliases: ADA1, HFI1, STAF42, TADA1L, hADA1
• Gene name: transcriptional adaptor 1
• Alternate names: transcriptional adapter 1, SPT3-associated factor 42 (STAF42), transcriptional adapter 1-like protein, transcriptional adaptor 1 (HFI1 homolog, yeast),
• Gene location: 1q24.1 (166876416: 166856509)     Exons: 8     NC_000001.11
• Gene summary(Entrez): TADA1L is a protein subunit of the human STAGA complex (SPT3; (MIM 602947)/TAF9 (MIM 600822)/GCN5 (MIM 602301) acetyltransferase complex), which is a chromatin-modifying multiprotein complex (Martinez et al., 2001 [PubMed 11564863]).[supplied by OMIM, Apr
• OMIM: 612763

Protein Summary

• Protein general information: Q96BN2  
  • Name: Transcriptional adapter 1 (SPT3 associated factor 42) (STAF42) (Transcriptional adapter 1 like protein)
  • Length: 335  
  • Mass: 37,382
• Sequence:

  MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQILVS
  TPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQ
  LEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAY
  NNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALN
  IERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

• Structural information:
  • Interpro: IPR024738  
  • STRING: ENSP00000356848
• Other Databases: GeneCards:  TADA1  Malacards:  TADA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030914	STAGA complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030914	STAGA complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0070461	SAGA-type complex	IEA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0030914	STAGA complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0004402	histone acetyltransferase activity	IDA	molecular function

Diseases

Associated diseases	References
Male factor infertility	MIK: 26166670
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 21919946

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26166670	Male infertility	ADA1 G22 A		400 (200 fertile men, 200 infertile men)	Male infertility	ADA1
21919946	Male infertility			125 (55 fertile men, 70 infertile men)	Male infertility	ADAT ADA2 and ADA1
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray