• Gene id: 116986

Gene Summary

• Gene Symbol: AGAP2   Gene   UCSC   Ensembl
• Aliases: CENTG1, GGAP2, PIKE
• Gene name: ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
• Alternate names: arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2, Arf GAP with GTP-binding protein-like, ANK repeat and PH domains 2, GTP-binding and GTPase activating protein 2, centaurin, gamma 1, cnt-g1, phosphatidylinositol 3-kinase enhancer, phosphoinosi,
• Gene location: 12q14.1 (57742200: 57723760)     Exons: 20     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the centaurin gamma-like family. It mediates anti-apoptotic effects of nerve growth factor by activating nuclear phosphoinositide 3-kinase. It is overexpressed in cancer cells, and promotes cancer cell invasion.
• OMIM: 605476

Protein Summary

• Protein general information: Q99490  
  • Name: Arf GAP with GTPase, ANK repeat and PH domain containing protein 2 (AGAP 2) (Centaurin gamma 1) (Cnt g1) (GTP binding and GTPase activating protein 2) (GGAP2) (Phosphatidylinositol 3 kinase enhancer) (PIKE)
  • Length: 1192  
  • Mass: 124674
  • Tissue specificity: Isoform 1 is brain-specific. Isoform 2 is ubiquitously expressed, with highest levels in brain and heart. {ECO
• Sequence:

  MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEEPGKKRHERLFHRQDA
  LWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPGPPLSGGLSPDSKPGGAPSSSRRPLLSSPSW
  GGPEPEGRTGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSK
  SSAGTGASVSAAATAAAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPS
  PATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPPGSGPLPGPPSLSSGS
  GSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDG
  QTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPR
  VVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
  NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRA
  IPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPS
  ASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPP
  PSPMVKKQRRKKLTTPSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDA
  WVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRN
  LGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAKPSRDSSREERESWIRAKYEQLLFLAPLSTS
  EEPLGRQLWAAVQAQDVATVLLLLAHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGR
  TALFYARQAGSQLCADILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV

• Structural information:
  • Protein Domains: (676..91-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (931..105-)
    (/note="Arf-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00288"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR037278  IPR001164   IPR038508  IPR027417  IPR011993  IPR001849  IPR001806  
  • Prosite: PS50297 PS50088 PS50115 PS50003 PS51419
  • PDB: 2BMJ 2IWR 2RLO
  • PDBsum: 2BMJ 2IWR 2RLO
  • STRING: ENSP00000449241
• Other Databases: GeneCards:  AGAP2  Malacards:  AGAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	TAS	molecular function
GO:0061903	positive regulation of 1-phosphatidylinositol-3-kinase activity	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042177	negative regulation of protein catabolic process	IDA	biological process
GO:0035014	phosphatidylinositol 3-kinase regulator activity	IDA	molecular function
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0030036	actin cytoskeleton organization	IDA	biological process
GO:0005768	endosome	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0019901	protein kinase binding	IDA	molecular function
GO:0016197	endosomal transport	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0043524	negative regulation of neuron apoptotic process	IGI	biological process
GO:0043524	negative regulation of neuron apoptotic process	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005634	nucleus	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
oral squamous cell carcinoma	PMID:26464646
Prostate cancer	PMID:19176382
Prostate cancer	PMID:19176382
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881