• Gene id: 116969

Gene Summary

• Gene Symbol: ART5   Gene   UCSC   Ensembl
• Aliases: ARTC5
• Gene name: ADP-ribosyltransferase 5
• Alternate names: ecto-ADP-ribosyltransferase 5, ADP-ribosyltransferase C2 and C3 toxin-like 5, NAD(P)(+)--arginine ADP-ribosyltransferase 5, mono(ADP-ribosyl)transferase 5,
• Gene location: 11p15.4 (3642391: 3638502)     Exons: 7     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolo
• OMIM: 612905

Protein Summary

• Protein general information: Q96L15  
  • Name: Ecto ADP ribosyltransferase 5 (EC 2.4.2.31) (ADP ribosyltransferase C2 and C3 toxin like 5) (ARTC5) (Mono(ADP ribosyl)transferase 5) (NAD(P)(+) arginine ADP ribosyltransferase 5)
  • Length: 291  
  • Mass: 32054
• Sequence:

  MALAALMIALGSLGLHTWQAQAVPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQETW
  EDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLRGSGGC
  SRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIP
  PHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMTKRHLQQP

• Structural information:
  • Interpro: IPR000768  
  • Prosite: PS01291
  • STRING: ENSP00000380258
• Other Databases: GeneCards:  ART5  Malacards:  ART5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003950	NAD+ ADP-ribosyltransferase activity	IBA	molecular function
GO:0018120	peptidyl-arginine ADP-ribosylation	IBA	biological process
GO:0006471	protein ADP-ribosylation	IBA	biological process
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	IEA	molecular function
GO:0006471	protein ADP-ribosylation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0003956	NAD(P)+-protein-arginine ADP-ribosyltransferase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray