• Gene id: 116844

Gene Summary

• Gene Symbol: LRG1   Gene   UCSC   Ensembl
• Aliases: HMFT1766, LRG
• Gene name: leucine rich alpha-2-glycoprotein 1
• Alternate names: leucine-rich alpha-2-glycoprotein, 1300008B03Rik, 2310031E04Rik, leucine rich alpha 2 glycoprotein,
• Gene location: 19p13.3 (4540035: 4536401)     Exons: 2     NC_000019.10
• Gene summary(Entrez): The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al.
• OMIM: 611289

Protein Summary

• Protein general information: P02750  
  • Name: Leucine rich alpha 2 glycoprotein (LRG)
  • Length: 347  
  • Mass: 38178
  • Tissue specificity: Plasma.
• Sequence:

  MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAV
  EFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKEN
  QLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQ
  VLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
  WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

• Structural information:
  • Protein Domains: (299..34-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • DIP: 60317
  • STRING: ENSP00000302621
• Other Databases: GeneCards:  LRG1  Malacards:  LRG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035580	specific granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0005160	transforming growth factor beta receptor binding	IEA	molecular function
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0016020	membrane	NAS	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R