• Gene id: 116843

Gene Summary

• Gene Symbol: SLC18B1   Gene   UCSC   Ensembl
• Aliases: C6orf192, dJ55C23.6
• Gene name: solute carrier family 18 member B1
• Alternate names: MFS-type transporter SLC18B1, MFS-type transporter C6orf192, solute carrier family 18, subfamily B, member 1,
• Gene location: 6q23.2 (132798655: 132769369)     Exons: 15     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein, which has high sequence similarity to rat, xenopus and zebrafish proteins. The protein function is unknown. [provided by RefSeq, Jul 2008]
• OMIM: 610662

Protein Summary

• Protein general information: Q6NT16  
  • Name: MFS type transporter SLC18B1 (Solute carrier family 18 member B1)
  • Length: 456  
  • Mass: 48869
• Sequence:

  MEALGDLEGPRAPGGDDPAGSAGETPGWLSREQVFVLISAASVNLGSMMCYSILGPFFPKEAEKKGASNTIIGMI
  FGCFALFELLASLVFGNYLVHIGAKFMFVAGMFVSGGVTILFGVLDRVPDGPVFIAMCFLVRVMDAVSFAAAMTA
  SSSILAKAFPNNVATVLGSLETFSGLGLILGPPVGGFLYQSFGYEVPFIVLGCVVLLMVPLNMYILPNYESDPGE
  HSFWKLIALPKVGLIAFVINSLSSCFGFLDPTLSLFVLEKFNLPAGYVGLVFLGMALSYAISSPLFGLLSDKRPP
  LRKWLLVFGNLITAGCYMLLGPVPILHIKSQLWLLVLILVVSGLSAGMSIIPTFPEILSCAHENGFEEGLSTLGL
  VSGLFSAMWSIGAFMGPTLGGFLYEKIGFEWAAAIQGLWALISGLAMGLFYLLEYSRRKRSKSQNILSTEEERTT
  LLPNET

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000275227
• Other Databases: GeneCards:  SLC18B1  Malacards:  SLC18B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881