• Gene id: 116842

Gene Summary

• Gene Symbol: LEAP2   Gene   UCSC   Ensembl
• Aliases: LEAP-2
• Gene name: liver enriched antimicrobial peptide 2
• Alternate names: liver-expressed antimicrobial peptide 2,
• Gene location: 5q31.1 (132873667: 132875045)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a cysteine-rich cationic antimicrobial peptide that is expressed predominantly in the liver. The mature peptide has activity against gram-positive bacteria and yeasts. [provided by RefSeq, Sep 2014]
• OMIM: 616317

Protein Summary

• Protein general information: Q969E1  
  • Name: Liver expressed antimicrobial peptide 2 (LEAP 2)
  • Length: 77  
  • Mass: 8814
• Sequence:

  MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVA
  QE

• Structural information:
  • Interpro: IPR009955  
  • PDB: 2L1Q
  • PDBsum: 2L1Q
  • STRING: ENSP00000296877
• Other Databases: GeneCards:  LEAP2  Malacards:  LEAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042742	defense response to bacterium	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0042742	defense response to bacterium	IEA	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray