• Gene id: 116840

Gene Summary

• Gene Symbol: CNTROB   Gene   UCSC   Ensembl
• Aliases: LIP8, PP1221
• Gene name: centrobin, centriole duplication and spindle assembly protein
• Alternate names: centrobin, LYST-interacting protein 8, LYST-interacting protein LIP8, centrobin, centrosomal BRCA2 interacting protein, centrosomal BRCA2-interacting protein,
• Gene location: 17p13.1 (7932053: 7949919)     Exons: 22     NC_000017.11
• Gene summary(Entrez): This gene encodes a centrosomal protein that interacts with BRCA2, and is required for centriole duplication and cytokinesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug
• OMIM: 610633

Protein Summary

• Protein general information: Q8N137  
  • Name: Centrobin (Centrosomal BRCA2 interacting protein) (LYST interacting protein 8)
  • Length: 903  
  • Mass: 101253
  • Tissue specificity: Widely expressed (at protein level). Highly expressed in testis. Also expressed in spleen, thymus, prostate, small intestine, colon and peripheral blood leukocytes. {ECO
• Sequence:

  MATSADSPSSPLGAEDLLSDSSEPPGLNQVSSEVTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQEL
  SRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPL
  QDLSPSSSAQALEELFPRYTSLRPGPPLNPPDFQGLRDALDSEHTRRKHCERHIQSLQTRVLELQQQLAVAVAAD
  RKKDTMIEQLDKTLARVVEGWNRHEAERTEVLRGLQEEHQAAELTRSKQQETVTRLEQSLSEAMEALNREQESAR
  LQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQLSEHRELETLRAALEEERQTWAQQEHQLKEHYQA
  LQEESQAQLEREKEKSQREAQAAWETQHQLALVQSEVRRLEGELDTARRERDALQLEMSLVQARYESQRIQLESE
  LAVQLEQRVTERLAQAQESSLRQAASLREHHRKQLQDLSGQHQQELASQLAQFKVEMAEREERQQQVAEDYELRL
  AREQARVCELQSGNQQLEEQRVELVERLQAMLQAHWDEANQLLSTTLPPPNPPAPPAGPSSPGPQEPEKEERRVW
  TMPPMAVALKPVLQQSREARDELPGAPPVLCSSSSDLSLLLGPSFQSQHSFQPLEPKPDLTSSTAGAFSALGAFH
  PDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNENPSVDLLPPKSGPLTVPSWEEAPQV
  PRIPPPVHKTKVPLAMASSLFRVPEPPSSHSQGSGPSSGSPERGGDGLTFPRQLMEVSQLLRLYQARGWGALPAE
  DLLLYLKRLEHSGTDGRGDNVPRRNTDSRLGEIPRKEIPSQAVPRRLATAPKTEKPPARKKSGHPAPSSMRSRGG
  VWR

• Structural information:
  • Interpro: IPR038923  
  • STRING: ENSP00000369614
• Other Databases: GeneCards:  CNTROB  Malacards:  CNTROB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007099	centriole replication	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005814	centriole	IDA	cellular component
GO:0051299	centrosome separation	IMP	biological process
GO:0005813	centrosome	IMP	cellular component
GO:0007099	centriole replication	IMP	biological process
GO:0007099	centriole replication	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:1902410	mitotic cytokinetic process	IBA	biological process
GO:0051299	centrosome separation	IBA	biological process
GO:0005814	centriole	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0007099	centriole replication	IEA	biological process
GO:1902017	regulation of cilium assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902410	mitotic cytokinetic process	IMP	biological process
GO:0005814	centriole	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq