• Gene id: 116832

Gene Summary

• Gene Symbol: RPL39L   Gene   UCSC   Ensembl
• Aliases: L39-2, RPL39L1
• Gene name: ribosomal protein L39 like
• Alternate names: 60S ribosomal protein L39-like, 60S ribosomal protein L39-2, large ribosomal subunit protein eL39-like, ribosomal protein L39-like 1, ribosomal protein L39-like protein,
• Gene location: 3q27.3 (187139495: 187120947)     Exons: 3     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein sharing high sequence similarity with ribosomal protein L39. Although the name of this gene has been referred to as 'ribosomal protein L39' in the public databases, its official name is 'ribosomal protein L39-like'. It is not c
• OMIM: 607547

Protein Summary

• Protein general information: Q96EH5  
  • Name: 60S ribosomal protein L39 like (60S ribosomal protein L39 2) (Large ribosomal subunit protein eL39 like)
  • Length: 51  
  • Mass: 6293
  • Tissue specificity: Testis specific.
• Sequence:

  MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL

• Structural information:
  • Interpro: IPR000077  IPR020083  IPR023626  
  • Prosite: PS00051
  • STRING: ENSP00000296277
• Other Databases: GeneCards:  RPL39L  Malacards:  RPL39L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0022625	cytosolic large ribosomal subunit	NAS	cellular component
GO:0007283	spermatogenesis	IEP	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R