• Gene id: 116541

Gene Summary

• Gene Symbol: MRPL54   Gene   UCSC   Ensembl
• Aliases: L54mt, MRP-L54
• Gene name: mitochondrial ribosomal protein L54
• Alternate names: 39S ribosomal protein L54, mitochondrial, mitochondrial large ribosomal subunit protein mL54,
• Gene location: 19p13.3 (3762681: 3767564)     Exons: 9     NC_000019.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611858

Protein Summary

• Protein general information: Q6P161  
  • Name: 39S ribosomal protein L54, mitochondrial (L54mt) (MRP L54) (Mitochondrial large ribosomal subunit protein mL54)
  • Length: 138  
  • Mass: 15819
• Sequence:

  MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGV
  NIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL

• Structural information:
  • Interpro: IPR013870  
  • PDB: 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000331849
• Other Databases: GeneCards:  MRPL54  Malacards:  MRPL54

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)