• Gene id: 116535

Gene Summary

• Gene Symbol: MRGPRF   Gene   UCSC   Ensembl
• Aliases: GPR140, GPR168, MRGF, RTA
• Gene name: MAS related GPR family member F
• Alternate names: mas-related G-protein coupled receptor member F, G protein-coupled receptor MrgF, G-protein coupled receptor 140, G-protein coupled receptor 168, MAS-related GPR, member F, Mas-related G protein-coupled receptor F, mas-related G protein-coupled MRGF, mas-related,
• Gene location: 11q13.3 (69013670: 69004374)     Exons: 5     NC_000011.10

Protein Summary

• Protein general information: Q96AM1  
  • Name: Mas related G protein coupled receptor member F (Mas related gene F protein) (G protein coupled receptor 140) (G protein coupled receptor 168)
  • Length: 343  
  • Mass: 38171
• Sequence:

  MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKR
  NPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAW
  YWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVE
  CRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQ
  RLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS

• Structural information:
  • Interpro: IPR019430  IPR000276  IPR017452  IPR026228  IPR026234  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000309782
• Other Databases: GeneCards:  MRGPRF  Malacards:  MRGPRF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray