• Gene id: 116519

Gene Summary

• Gene Symbol: APOA5   Gene   UCSC   Ensembl
• Aliases: APOAV, RAP3
• Gene name: apolipoprotein A5
• Alternate names: apolipoprotein A-V, apo-AV, apolipoprotein A-V precursor variant 3, regeneration-associated protein 3,
• Gene location: 11q23.3 (116792419: 116789366)     Exons: 4     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is an apolipoprotein that plays an important role in regulating the plasma triglyceride levels, a major risk factor for coronary artery disease. It is a component of high density lipoprotein and is highly similar to a rat
• OMIM: 617289

Protein Summary

• Protein general information: Q6Q788  
  • Name: Apolipoprotein A V (Apo AV) (ApoA V) (Apolipoprotein A5) (Regeneration associated protein 3)
  • Length: 366  
  • Mass: 41213
  • Tissue specificity: Liver and plasma. {ECO
• Sequence:

  MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSLEQDLNNMNKFLEKLR
  PLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGWNLEGLRQQLKPYTMDLMEQVALRVQELQEQ
  LRVVGEDTKAQLLGGVDEAWALLQGLQSRVVHHTGRFKELFHPYAESLVSGIGRHVQELHRSVAPHAPASPARLS
  RCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFT
  RAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGHSHLGDP

• Structural information:
  • Interpro: IPR000074  
  • STRING: ENSP00000445002
• Other Databases: GeneCards:  APOA5  Malacards:  APOA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006641	triglyceride metabolic process	IMP	biological process
GO:0006641	triglyceride metabolic process	IMP	biological process
GO:0006641	triglyceride metabolic process	IMP	biological process
GO:0070328	triglyceride homeostasis	IBA	biological process
GO:0060228	phosphatidylcholine-sterol O-acyltransferase activator activity	IBA	molecular function
GO:0046470	phosphatidylcholine metabolic process	IBA	biological process
GO:0045723	positive regulation of fatty acid biosynthetic process	IBA	biological process
GO:0042632	cholesterol homeostasis	IBA	biological process
GO:0042627	chylomicron	IBA	cellular component
GO:0042157	lipoprotein metabolic process	IBA	biological process
GO:0034372	very-low-density lipoprotein particle remodeling	IBA	biological process
GO:0033344	cholesterol efflux	IBA	biological process
GO:0031210	phosphatidylcholine binding	IBA	molecular function
GO:0006695	cholesterol biosynthetic process	IBA	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IBA	biological process
GO:0046889	positive regulation of lipid biosynthetic process	IBA	biological process
GO:0034380	high-density lipoprotein particle assembly	IBA	biological process
GO:0034364	high-density lipoprotein particle	IBA	cellular component
GO:0033700	phospholipid efflux	IBA	biological process
GO:0030300	regulation of intestinal cholesterol absorption	IBA	biological process
GO:0015485	cholesterol binding	IBA	molecular function
GO:0010898	positive regulation of triglyceride catabolic process	IBA	biological process
GO:0010873	positive regulation of cholesterol esterification	IBA	biological process
GO:0005543	phospholipid binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042157	lipoprotein metabolic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0042627	chylomicron	IEA	cellular component
GO:0034361	very-low-density lipoprotein particle	IEA	cellular component
GO:0034364	high-density lipoprotein particle	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034370	triglyceride-rich lipoprotein particle remodeling	IEA	biological process
GO:0055090	acylglycerol homeostasis	IEA	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0031210	phosphatidylcholine binding	IDA	molecular function
GO:0060230	lipoprotein lipase activator activity	IDA	molecular function
GO:0060229	lipase activator activity	IMP	molecular function
GO:0070325	lipoprotein particle receptor binding	IPI	molecular function
GO:0070325	lipoprotein particle receptor binding	IPI	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0008047	enzyme activator activity	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0019899	enzyme binding	IDA	molecular function
GO:0035473	lipase binding	IPI	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0034362	low-density lipoprotein particle	IDA	NOT|cellular component
GO:0042632	cholesterol homeostasis	IDA	biological process
GO:0045723	positive regulation of fatty acid biosynthetic process	IDA	biological process
GO:0055090	acylglycerol homeostasis	IDA	biological process
GO:0070328	triglyceride homeostasis	IDA	biological process
GO:0006869	lipid transport	IDA	biological process
GO:0006641	triglyceride metabolic process	IDA	biological process
GO:0010898	positive regulation of triglyceride catabolic process	IDA	biological process
GO:0010902	positive regulation of very-low-density lipoprotein particle remodeling	IDA	biological process
GO:0034361	very-low-density lipoprotein particle	IDA	cellular component
GO:0034364	high-density lipoprotein particle	IDA	cellular component
GO:0050996	positive regulation of lipid catabolic process	IDA	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IDA	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IDA	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IDA	biological process
GO:0019433	triglyceride catabolic process	IMP	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	TAS	biological process
GO:0055090	acylglycerol homeostasis	IMP	biological process
GO:0070328	triglyceride homeostasis	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0042627	chylomicron	IDA	cellular component
GO:0008289	lipid binding	IDA	molecular function
GO:0042246	tissue regeneration	IEP	biological process
GO:0006641	triglyceride metabolic process	IMP	biological process
GO:0006641	triglyceride metabolic process	IMP	biological process
GO:0006641	triglyceride metabolic process	IMP	biological process
GO:0070328	triglyceride homeostasis	IBA	biological process
GO:0060228	phosphatidylcholine-sterol O-acyltransferase activator activity	IBA	molecular function
GO:0046470	phosphatidylcholine metabolic process	IBA	biological process
GO:0045723	positive regulation of fatty acid biosynthetic process	IBA	biological process
GO:0042632	cholesterol homeostasis	IBA	biological process
GO:0042627	chylomicron	IBA	cellular component
GO:0042157	lipoprotein metabolic process	IBA	biological process
GO:0034372	very-low-density lipoprotein particle remodeling	IBA	biological process
GO:0033344	cholesterol efflux	IBA	biological process
GO:0031210	phosphatidylcholine binding	IBA	molecular function
GO:0006695	cholesterol biosynthetic process	IBA	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IBA	biological process
GO:0046889	positive regulation of lipid biosynthetic process	IBA	biological process
GO:0034380	high-density lipoprotein particle assembly	IBA	biological process
GO:0034364	high-density lipoprotein particle	IBA	cellular component
GO:0033700	phospholipid efflux	IBA	biological process
GO:0030300	regulation of intestinal cholesterol absorption	IBA	biological process
GO:0015485	cholesterol binding	IBA	molecular function
GO:0010898	positive regulation of triglyceride catabolic process	IBA	biological process
GO:0010873	positive regulation of cholesterol esterification	IBA	biological process
GO:0005543	phospholipid binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042157	lipoprotein metabolic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0042627	chylomicron	IEA	cellular component
GO:0034361	very-low-density lipoprotein particle	IEA	cellular component
GO:0034364	high-density lipoprotein particle	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034370	triglyceride-rich lipoprotein particle remodeling	IEA	biological process
GO:0055090	acylglycerol homeostasis	IEA	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0031210	phosphatidylcholine binding	IDA	molecular function
GO:0060230	lipoprotein lipase activator activity	IDA	molecular function
GO:0060229	lipase activator activity	IMP	molecular function
GO:0070325	lipoprotein particle receptor binding	IPI	molecular function
GO:0070325	lipoprotein particle receptor binding	IPI	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0008047	enzyme activator activity	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0019899	enzyme binding	IDA	molecular function
GO:0035473	lipase binding	IPI	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0034362	low-density lipoprotein particle	IDA	NOT|cellular component
GO:0042632	cholesterol homeostasis	IDA	biological process
GO:0045723	positive regulation of fatty acid biosynthetic process	IDA	biological process
GO:0055090	acylglycerol homeostasis	IDA	biological process
GO:0070328	triglyceride homeostasis	IDA	biological process
GO:0006869	lipid transport	IDA	biological process
GO:0006641	triglyceride metabolic process	IDA	biological process
GO:0010898	positive regulation of triglyceride catabolic process	IDA	biological process
GO:0010902	positive regulation of very-low-density lipoprotein particle remodeling	IDA	biological process
GO:0034361	very-low-density lipoprotein particle	IDA	cellular component
GO:0034364	high-density lipoprotein particle	IDA	cellular component
GO:0050996	positive regulation of lipid catabolic process	IDA	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IDA	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IDA	biological process
GO:0051006	positive regulation of lipoprotein lipase activity	IDA	biological process
GO:0019433	triglyceride catabolic process	IMP	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	TAS	biological process
GO:0055090	acylglycerol homeostasis	IMP	biological process
GO:0070328	triglyceride homeostasis	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0042627	chylomicron	IDA	cellular component
GO:0008289	lipid binding	IDA	molecular function
GO:0042246	tissue regeneration	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03320	PPAR signaling pathway

Diseases

Associated diseases	References
Primary hyperchylomicronemia	KEGG:H01784
Hyperlipidemia	KEGG:H01635
Hyperlipoproteinemia, type V	KEGG:H00157
Primary hyperchylomicronemia	KEGG:H01784
Hyperlipidemia	KEGG:H01635
Hyperlipoproteinemia, type V	KEGG:H00157
Coronary artery disease	PMID:15177130
Cerebral infarction	PMID:19107359
type 2 diabetes mellitus	PMID:16039297
type 2 diabetes mellitus	PMID:17548321
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R