• Gene id: 116461

Gene Summary

• Gene Symbol: TSEN15   Gene   UCSC   Ensembl
• Aliases: C1orf19, PCH2F, sen15
• Gene name: tRNA splicing endonuclease subunit 15
• Alternate names: tRNA-splicing endonuclease subunit Sen15, TSEN15 tRNA splicing endonuclease subunit, tRNA splicing endonuclease 15 homolog, tRNA-intron endonuclease Sen15,
• Gene location: 1q25.3 (184051729: 184097484)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. [provided by Ref
• OMIM: 601747

Protein Summary

• Protein general information: Q8WW01  
  • Name: tRNA splicing endonuclease subunit Sen15 (SEN15 homolog) (HsSEN15) (tRNA intron endonuclease Sen15)
  • Length: 171  
  • Mass: 18641
  • Tissue specificity: Widely expressed. Highly expressed in testis and uterus. {ECO
• Sequence:

  MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKS
  WHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTI
  VYYKLTDGFMLPDPQNISLRR

• Structural information:
  • Interpro: IPR018593  IPR011856  IPR036167  
  • PDB: 2GW6
  • PDBsum: 2GW6
  • STRING: ENSP00000355299
• Other Databases: GeneCards:  TSEN15  Malacards:  TSEN15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004518	nuclease activity	IEA	molecular function
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process

Diseases

Associated diseases	References
Pontocerebellar hypoplasia	KEGG:H00897
Pontocerebellar hypoplasia	KEGG:H00897
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881