• Gene id: 116448

Gene Summary

• Gene Symbol: OLIG1   Gene   UCSC   Ensembl
• Aliases: BHLHB6, BHLHE21
• Gene name: oligodendrocyte transcription factor 1
• Alternate names: oligodendrocyte transcription factor 1, basic domain, helix-loop-helix protein, class B, 6, class B basic helix-loop-helix protein 6, class E basic helix-loop-helix protein 21, oligo1, oligodendrocyte lineage transcription factor 1, oligodendrocyte-specific bHL,
• Gene location: 21q22.11 (23927171: 24004908)     Exons: 11     NC_000002.12
• OMIM: 606385

Protein Summary

• Protein general information: Q8TAK6  
  • Name: Oligodendrocyte transcription factor 1 (Oligo1) (Class B basic helix loop helix protein 6) (bHLHb6) (Class E basic helix loop helix protein 21) (bHLHe21)
  • Length: 271  
  • Mass: 27905
  • Tissue specificity: Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable. {ECO
• Sequence:

  MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEA
  PAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSK
  IATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALD
  EPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK

• Structural information:
  • Protein Domains: (105..16-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR036638  IPR032657  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000371785
• Other Databases: GeneCards:  OLIG1  Malacards:  OLIG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048663	neuron fate commitment	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048663	neuron fate commitment	IEA	biological process
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray