• Gene id: 116443

Gene Summary

• Gene Symbol: GRIN3A   Gene   UCSC   Ensembl
• Aliases: GluN3A, NMDAR-L, NMDAR3A, NR3A
• Gene name: glutamate ionotropic receptor NMDA type subunit 3A
• Alternate names: glutamate receptor ionotropic, NMDA 3A, N-methyl-D-aspartate receptor subtype 3A, glutamate [NMDA] receptor subunit 3A, glutamate receptor, ionotropic, N-methyl-D-aspartate 3A,
• Gene location: 9q31.1 (101738646: 101569351)     Exons: 10     NC_000009.12
• Gene summary(Entrez): This gene encodes a subunit of the N-methyl-D-aspartate (NMDA) receptors, which belong to the superfamily of glutamate-regulated ion channels, and function in physiological and pathological processes in the central nervous system. This subunit shows great
• OMIM: 615405

Protein Summary

• Protein general information: Q8TCU5  
  • Name: Glutamate receptor ionotropic, NMDA 3A (GluN3A) (N methyl D aspartate receptor subtype 3A) (NMDAR3A) (NR3A) (NMDAR L)
  • Length: 1115  
  • Mass: 125465
• Sequence:

  MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTTAPRAASRAPDDSRAG
  AQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAEALWPRDALLFAVDNLNRVEGLLPYNLSLEV
  VMAIEAGLGDLPLLPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSLVLHIPVISIVR
  HEFPRESQNPLHLQLSLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
  LPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPPELRWVLGDSQNVEELRTEGLPLGLI
  AHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCMEVETTNLTSGQYLSRFLANTTFRGLSGSIR
  VKGSTIVSSENNFFIWNLQHDPMGKPMWTRLGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPF
  VFTREVDDEGLCPAGQLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIV
  GDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHW
  TMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWA
  IFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPAT
  PDGVEYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFM
  DMLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHT
  SQRLHRAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLSHDNRRKYIFSDEEGQNQLGIRIHQDIPLPP
  RRRELPALRTTNGKADSLNVSRNSVMQELSELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES

• Structural information:
  • Interpro: IPR019594  IPR001508  IPR001320  IPR028082  
  • STRING: ENSP00000355155
• Other Databases: GeneCards:  GRIN3A  Malacards:  GRIN3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0035235	ionotropic glutamate receptor signaling pathway	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0015276	ligand-gated ion channel activity	IBA	molecular function
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0004970	ionotropic glutamate receptor activity	IEA	molecular function
GO:0015276	ligand-gated ion channel activity	IEA	molecular function
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0016358	dendrite development	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0004972	NMDA glutamate receptor activity	IEA	molecular function
GO:0060134	prepulse inhibition	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0045202	synapse	IDA	cellular component
GO:0043025	neuronal cell body	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0045471	response to ethanol	IDA	biological process
GO:0043005	neuron projection	IDA	cellular component
GO:0017146	NMDA selective glutamate receptor complex	IDA	cellular component
GO:0045471	response to ethanol	IDA	biological process
GO:0016594	glycine binding	IDA	molecular function
GO:0004972	NMDA glutamate receptor activity	IDA	molecular function
GO:0051721	protein phosphatase 2A binding	ISS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006816	calcium ion transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004972	NMDA glutamate receptor activity	ISS	contributes to

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa05034	Alcoholism
hsa05017	Spinocerebellar ataxia
hsa04724	Glutamatergic synapse
hsa05031	Amphetamine addiction
hsa05030	Cocaine addiction
hsa05033	Nicotine addiction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq