• Gene id: 1164

Gene Summary

• Gene Symbol: CKS2   Gene   UCSC   Ensembl
• Aliases: CKSHS2
• Gene name: CDC28 protein kinase regulatory subunit 2
• Alternate names: cyclin-dependent kinases regulatory subunit 2, CDC28 protein kinase 2, CKS-2, CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2,
• Gene location: 9q22.2 (89311194: 89316702)     Exons: 3     NC_000009.12
• Gene summary(Entrez): CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role
• OMIM: 600535

SNPs

rs2292596

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.422840C>G
NC_000005.10   g.422840C>T
NC_000005.9   g.422955C>G
NC_000005.9   g.422955C>T
NG_029834.2   g.123665C>G
NG_029834.2   g.123665C>T
NG_029834.1   g.123665C>G
NG_029834.1   g.123665C>T
NM_020731.4   c.565C>G
NM_020731.4   c.565C>T
NM_001242412.1  

Protein Summary

• Protein general information: P33552  
  • Name: Cyclin dependent kinases regulatory subunit 2 (CKS 2)
  • Length: 79  
  • Mass: 9860
• Sequence:

  MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPK
  DQQK

• Structural information:
  • Interpro: IPR000789  IPR036858  
  • Prosite: PS00944 PS00945
  • PDB: 1CKS 4Y72 4YC3 5HQ0 5LQF 6GU2 6GU3 6GU4 6GU6 6GU7
  • PDBsum: 1CKS 4Y72 4YC3 5HQ0 5LQF 6GU2 6GU3 6GU4 6GU6 6GU7
  • STRING: ENSP00000364976
• Other Databases: GeneCards:  CKS2  Malacards:  CKS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0019901	protein kinase binding	IBA	molecular function
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IBA	molecular function
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0042393	histone binding	IBA	molecular function
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:0007127	meiosis I	IEA	biological process
GO:0044772	mitotic cell cycle phase transition	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05222	Small cell lung cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray