• Gene id: 116379

Gene Summary

• Gene Symbol: IL22RA2   Gene   UCSC   Ensembl
• Aliases: CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2, IL-22RA2, ZCYTOR16
• Gene name: interleukin 22 receptor subunit alpha 2
• Alternate names: interleukin-22 receptor subunit alpha-2, cytokine receptor class-II member 10, cytokine receptor family type 2, soluble 1, interleukin 22 receptor, alpha 2, interleukin 22-binding protein,
• Gene location: 6q23.3 (59906555: 59788746)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein m
• OMIM: 606648

Protein Summary

• Protein general information: Q969J5  
  • Name: Interleukin 22 receptor subunit alpha 2 (IL 22 receptor subunit alpha 2) (IL 22R alpha 2) (IL 22RA2) (Cytokine receptor class II member 10) (Cytokine receptor family 2 member 10) (CRF2 10) (Cytokine receptor family type 2, soluble 1) (CRF2 S1) (Interleuki
  • Length: 263  
  • Mass: 30550
  • Tissue specificity: Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expr
• Sequence:

  MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSS
  HQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTP
  RFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRA
  VEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

• Structural information:
  • Protein Domains: (26..6-)
    1 (/note="Fibronectin-type-III)
    (100..16-)
    2 (/note="Fibronectin-type-III)
    (162..26-)
    3" (/note="Fibronectin-type-III)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR015373  
  • PDB: 3G9V
  • PDBsum: 3G9V
  • DIP: 46036
  • STRING: ENSP00000296980
• Other Databases: GeneCards:  IL22RA2  Malacards:  IL22RA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042018	interleukin-22 receptor activity	IBA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0042509	regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0042017	interleukin-22 binding	IDA	molecular function
GO:0042018	interleukin-22 receptor activity	IDA	molecular function
GO:0042509	regulation of tyrosine phosphorylation of STAT protein	ISS	biological process
GO:0005615	extracellular space	NAS	cellular component
GO:0005615	extracellular space	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)