• Gene id: 116362

Gene Summary

• Gene Symbol: RBP7   Gene   UCSC   Ensembl
• Aliases: CRABP4, CRBP4, CRBPIV
• Gene name: retinol binding protein 7
• Alternate names: retinoid-binding protein 7, cellular retinoic acid-binding protein 4, cellular retinoic acid-binding protein IV, cellular retinol binding protein 7, putative cellular retinol-binding protein CRBP IV, retinol binding protein 7, cellular,
• Gene location: 1p36.22 (9997227: 10016020)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs;
• OMIM: 607021

Protein Summary

• Protein general information: Q96R05  
  • Name: Retinoid binding protein 7 (Cellular retinoic acid binding protein 4) (CRABP4) (CRBP4) (Cellular retinoic acid binding protein IV) (CRABP IV)
  • Length: 134  
  • Mass: 15536
  • Tissue specificity: Expressed primarily in kidney, heart and transverse colon. Detected in adult lymph node, appendix, ascending colon, and in fetal heart and spleen. {ECO
• Sequence:

  MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDN
  RGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

• Structural information:
  • Interpro: IPR012674  IPR000463  IPR031259  IPR000566  
  • Prosite: PS00214
  • PDB: 1LPJ 6AT8 6E6K
  • PDBsum: 1LPJ 6AT8 6E6K
  • STRING: ENSP00000294435
• Other Databases: GeneCards:  RBP7  Malacards:  RBP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0016918	retinal binding	IEA	molecular function
GO:0019841	retinol binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005501	retinoid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881