• Gene id: 116337

Gene Summary

• Gene Symbol: PANX3   Gene   UCSC   Ensembl
• Aliases: PX3
• Gene name: pannexin 3
• Alternate names: pannexin-3, gap junction protein pannexin 3,
• Gene location: 11q24.2 (124611427: 124620355)     Exons: 4     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions. [provided by RefSeq, Jul 2008]
• OMIM: 608422

Protein Summary

• Protein general information: Q96QZ0  
  • Name: Pannexin 3
  • Length: 392  
  • Mass: 44683
• Sequence:

  MSLAHTAAEYMLSDALLPDRRGPRLKGLRLELPLDRIVKFVAVGSPLLLMSLAFAQEFSSGSPISCFSPSNFSIR
  QAAYVDSSCWDSLLHHKQDGPGQDKMKSLWPHKALPYSLLALALLMYLPVLLWQYAAVPALSSDLLFIISELDKS
  YNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLLERYLACKQRSHSLVATYLLRNSLLLIFTSATYL
  YLGHFHLDVFFQEEFSCSIKTGLLSDETHVPNLITCRLTSLSIFQIVSLSSVAIYTILVPVIIYNLTRLCRWDKR
  LLSVYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLCVLKDTTTQKHNIDTVVDFMTLLAGL
  EPSKPKHLTNSACDEHP

• Structural information:
  • Interpro: IPR000990  IPR039099  
  • Prosite: PS51013
  • STRING: ENSP00000284288
• Other Databases: GeneCards:  PANX3  Malacards:  PANX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022829	wide pore channel activity	IBA	molecular function
GO:0007267	cell-cell signaling	IBA	biological process
GO:0006812	cation transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0015267	channel activity	IEA	molecular function
GO:0050716	positive regulation of interleukin-1 secretion	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005921	gap junction	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007267	cell-cell signaling	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005921	gap junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005198	structural molecule activity	ISS	molecular function
GO:0055077	gap junction hemi-channel activity	ISS	NOT|molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)