• Gene id: 116255

Gene Summary

• Gene Symbol: MOGAT1   Gene   UCSC   Ensembl
• Aliases: DGAT2L, DGAT2L1, MGAT1
• Gene name: monoacylglycerol O-acyltransferase 1
• Alternate names: 2-acylglycerol O-acyltransferase 1, acyl-CoA:monoacylglycerol acyltransferase 1, diacylglycerol O-acyltransferase 2 like 1, diacylglycerol O-acyltransferase candidate 2, diacylglycerol acyltransferase 2-like protein 1, hDC2,
• Gene location: 2q36.1 (222671657: 222709929)     Exons: 6     NC_000002.12
• Gene summary(Entrez): Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM,
• OMIM: 610268

Protein Summary

• Protein general information: Q96PD6  
  • Name: 2 acylglycerol O acyltransferase 1 (EC 2.3.1.22) (Acyl CoA:monoacylglycerol acyltransferase 1) (MGAT1) (Diacylglycerol O acyltransferase candidate 2) (hDC2) (Diacylglycerol acyltransferase 2 like protein 1) (Monoacylglycerol O acyltransferase 1)
  • Length: 335  
  • Mass: 38812
• Sequence:

  MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWI
  KNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCP
  VFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVV
  SFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQE
  QIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

• Structural information:
  • Interpro: IPR007130  
  • STRING: ENSP00000406674
• Other Databases: GeneCards:  MOGAT1  Malacards:  MOGAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008374	O-acyltransferase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0004144	diacylglycerol O-acyltransferase activity	IBA	molecular function
GO:0019432	triglyceride biosynthetic process	IBA	biological process
GO:0006651	diacylglycerol biosynthetic process	IBA	biological process
GO:0006629	lipid metabolic process	IBA	biological process
GO:0016747	transferase activity, transferring acyl groups other than amino-acyl groups	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0006071	glycerol metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003846	2-acylglycerol O-acyltransferase activity	IEA	molecular function
GO:0019432	triglyceride biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0004144	diacylglycerol O-acyltransferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003846	2-acylglycerol O-acyltransferase activity	IEA	molecular function
GO:0006651	diacylglycerol biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0019432	triglyceride biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)