• Gene id: 116238

Gene Summary

• Gene Symbol: TLCD1   Gene   UCSC   Ensembl
• Gene name: TLC domain containing 1
• Alternate names: TLC domain-containing protein 1, calfacilitin,
• Gene location: 17q11.2 (28727929: 28724023)     Exons: 6     NC_000017.11

Protein Summary

• Protein general information: Q96CP7  
  • Name: TLC domain containing protein 1 (Calfacilitin)
  • Length: 247  
  • Mass: 28548
• Sequence:

  MPRLLHPALPLLLGATLTFRALRRALCRLPLPVHVRADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVE
  IETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIF
  LTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRL
  LRSDFCPEHVPKKQHKDKFLTE

• Structural information:
  • Protein Domains: (40..23-)
    (/note="TLC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00205"-)
  • Interpro: IPR006634  
  • Prosite: PS50922
  • STRING: ENSP00000292090
• Other Databases: GeneCards:  TLCD1  Malacards:  TLCD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0097035	regulation of membrane lipid distribution	IMP	biological process
GO:0007009	plasma membrane organization	IMP	biological process
GO:0071709	membrane assembly	IMP	biological process
GO:0055091	phospholipid homeostasis	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881