• Gene id: 116154

Gene Summary

• Gene Symbol: PHACTR3   Gene   UCSC   Ensembl
• Aliases: C20orf101, H17739, PPP1R123, SCAPIN1, SCAPININ
• Gene name: phosphatase and actin regulator 3
• Alternate names: phosphatase and actin regulator 3, protein phosphatase 1, regulatory subunit 123, scaffold-associated PP1-inhibiting protein,
• Gene location: 20q13.32-q13.33 (59577496: 59849828)     Exons: 21     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the phosphatase and actin regulator protein family. The encoded protein is associated with the nuclear scaffold in proliferating cells, and binds to actin and the catalytic subunit of protein phosphatase-1, suggesting that it
• OMIM: 606651

Protein Summary

• Protein general information: Q96KR7  
  • Name: Phosphatase and actin regulator 3 (Scaffold associated PP1 inhibiting protein) (Scapinin)
  • Length: 559  
  • Mass: 62552
  • Tissue specificity: Abundantly expressed in brain. Also found in several tumors such as lung carcinomas, nervous tumors and HL-60 leukemia cells. Isoform 3 is the major form in U-937, GOTO and HL-60 leukemia cells.
• Sequence:

  MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTPPVRRNSKLATLGRIF
  KPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSE
  DAQPGSPLATGTDQVSLDKPLSSAAHLDDAAKMPSASSGEEADAGSLLPTTNELSQALAGADSLDSPPRPLERSV
  GQLPSPPLLPTPPPKASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPHLTTVHRPLPPSRVIEELHRA
  LATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALENKRTAAKESEENKENLIINSELKDD
  LLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRNIFPRRTDEERQEIRQQIEMKLSKRLSQRPA
  VEELERRNILKQRNDQTEQEERREIKQRLTRKLNQRPTVDELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLS
  AADKAAIRKELNEYKSNEMEVHASSKHLTRFHRP

• Structural information:
  • Interpro: IPR029990  IPR004018  
  • Prosite: PS51073
  • STRING: ENSP00000360054
• Other Databases: GeneCards:  PHACTR3  Malacards:  PHACTR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0003779	actin binding	IBA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008157	protein phosphatase 1 binding	IEA	molecular function
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq