• Gene id: 116135

Gene Summary

• Gene Symbol: LRRC3B   Gene   UCSC   Ensembl
• Aliases: LRP15
• Gene name: leucine rich repeat containing 3B
• Alternate names: leucine-rich repeat-containing protein 3B, leucine-rich repeat protein LRP15,
• Gene location: 3p24.1 (26622805: 26717300)     Exons: 9     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hype

Protein Summary

• Protein general information: Q96PB8  
  • Name: Leucine rich repeat containing protein 3B (Leucine rich repeat protein LRP15)
  • Length: 259  
  • Mass: 29275
• Sequence:

  MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQ
  ITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCD
  CTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYV
  RQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV

• Structural information:
  • Protein Domains: (34..6-)
    (/note="LRRNT-)
    (145..19-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • PDB: 5EMA
  • PDBsum: 5EMA
  • STRING: ENSP00000379880
• Other Databases: GeneCards:  LRRC3B  Malacards:  LRRC3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray