• Gene id: 116071

Gene Summary

• Gene Symbol: BATF2   Gene   UCSC   Ensembl
• Aliases: SARI
• Gene name: basic leucine zipper ATF-like transcription factor 2
• Alternate names: basic leucine zipper transcriptional factor ATF-like 2, B-ATF-2, basic leucine zipper transcription factor, ATF-like 2, suppressor of AP-1 regulated by IFN,
• Gene location: 11q13.1 (64996970: 64987944)     Exons: 4     NC_000011.10
• OMIM: 614983

Protein Summary

• Protein general information: Q8N1L9  
  • Name: Basic leucine zipper transcriptional factor ATF like 2 (B ATF 2) (Suppressor of AP 1 regulated by IFN) (SARI)
  • Length: 274  
  • Mass: 29398
• Sequence:

  MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAELAWWSR
  TLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQ
  CPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDN
  PSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF

• Structural information:
  • Protein Domains: (17..8-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR000837  IPR029857  IPR004827  
  • Prosite: PS50217 PS00036
  • DIP: 48662
  • STRING: ENSP00000301887
• Other Databases: GeneCards:  BATF2  Malacards:  BATF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0042832	defense response to protozoan	ISS	biological process
GO:0043011	myeloid dendritic cell differentiation	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042832	defense response to protozoan	IEA	biological process
GO:0043011	myeloid dendritic cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881