• Gene id: 116068

Gene Summary

• Gene Symbol: LYSMD3   Gene   UCSC   Ensembl
• Gene name: LysM domain containing 3
• Alternate names: lysM and putative peptidoglycan-binding domain-containing protein 3, LysM, putative peptidoglycan-binding, domain containing 3,
• Gene location: 5q14.3 (90529615: 90515625)     Exons: 9     NC_000005.10

Protein Summary

• Protein general information: Q7Z3D4  
  • Name: LysM and putative peptidoglycan binding domain containing protein 3
  • Length: 306  
  • Mass: 34538
• Sequence:

  MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTL
  NAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQYSSEQQEILPANDS
  LAYSDSAGSFLKEVDRDIEQIVKCTDNKRENLNEVVSALTAQQMRFEPDNKNTQRKDPYYGADWGIGWWTAVVIM
  LIVGIITPVFYLLYYEILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSP
  AAQQET

• Structural information:
  • Protein Domains: (65..10-)
    (/note="LysM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01118"-)
  • Interpro: IPR018392  IPR036779  
  • Prosite: PS51782
  • CDD: cd00118
  • STRING: ENSP00000314518
• Other Databases: GeneCards:  LYSMD3  Malacards:  LYSMD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007030	Golgi organization	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)