• Gene id: 116039

Gene Summary

• Gene Symbol: OSR2   Gene   UCSC   Ensembl
• Gene name: odd-skipped related transciption factor 2
• Alternate names: protein odd-skipped-related 2, odd-skipped related 2,
• Gene location: 8q22.2 (98944402: 98952103)     Exons: 6     NC_000008.11
• Gene summary(Entrez): OSR2 is a mammalian homolog of the Drosophila odd-skipped family of transcription factors (Lan et al., 2004 [PubMed 15175245]).[supplied by OMIM, Mar 2008]
• OMIM: 604574

Protein Summary

• Protein general information: Q8N2R0  
  • Name: Protein odd skipped related 2
  • Length: 312  
  • Mass: 35513
• Sequence:

  MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTITEMAAA
  QGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLSPGLGSPISGL
  SKLTPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKE
  KPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLR
  RHSLTHTPRQDF

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000414657
• Other Databases: GeneCards:  OSR2  Malacards:  OSR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001655	urogenital system development	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030154	cell differentiation	ISS	biological process
GO:0030501	positive regulation of bone mineralization	ISS	biological process
GO:0036023	embryonic skeletal limb joint morphogenesis	ISS	biological process
GO:0072498	embryonic skeletal joint development	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0002062	chondrocyte differentiation	ISS	biological process
GO:0035115	embryonic forelimb morphogenesis	ISS	biological process
GO:0035116	embryonic hindlimb morphogenesis	ISS	biological process
GO:0042733	embryonic digit morphogenesis	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0060272	embryonic skeletal joint morphogenesis	ISS	biological process
GO:0060322	head development	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0060349	bone morphogenesis	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0050679	positive regulation of epithelial cell proliferation	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0001823	mesonephros development	ISS	biological process
GO:0001656	metanephros development	ISS	biological process
GO:0060021	roof of mouth development	ISS	biological process
GO:0048704	embryonic skeletal system morphogenesis	ISS	biological process
GO:0042476	odontogenesis	ISS	biological process
GO:0042474	middle ear morphogenesis	ISS	biological process
GO:0033687	osteoblast proliferation	ISS	biological process
GO:0009792	embryo development ending in birth or egg hatching	ISS	biological process
GO:0061029	eyelid development in camera-type eye	ISS	biological process
GO:0043565	sequence-specific DNA binding	ISS	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray