• Gene id: 115827

Gene Summary

• Gene Symbol: RAB3C   Gene   UCSC   Ensembl
• Gene name: RAB3C, member RAS oncogene family
• Alternate names: ras-related protein Rab-3C,
• Gene location: 5q11.2 (65373798: 65401135)     Exons: 5     NC_000007.14
• Gene summary(Entrez): This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to t
• OMIM: 612829

Protein Summary

• Protein general information: Q96E17  
  • Name: Ras related protein Rab 3C
  • Length: 227  
  • Mass: 25952
  • Tissue specificity: Expressed in brain, placenta and lung. {ECO
• Sequence:

  MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKN
  EKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDE
  RVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNC
  AC

• Structural information:
  • Interpro: IPR027417  IPR037872  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd01865
  • STRING: ENSP00000282878
• Other Databases: GeneCards:  RAB3C  Malacards:  RAB3C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0017157	regulation of exocytosis	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006904	vesicle docking involved in exocytosis	IBA	biological process
GO:0009306	protein secretion	IBA	biological process
GO:0031982	vesicle	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030742	GTP-dependent protein binding	IEA	molecular function
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031489	myosin V binding	IPI	molecular function
GO:0019882	antigen processing and presentation	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)