• Gene id: 115825

Gene Summary

• Gene Symbol: WDFY2   Gene   UCSC   Ensembl
• Aliases: PROF, WDF2, ZFYVE22
• Gene name: WD repeat and FYVE domain containing 2
• Alternate names: WD repeat and FYVE domain-containing protein 2, WD40 and FYVE domain containing 2, WD40- and FYVE domain-containing protein 2, propeller-FYVE protein, zinc finger FYVE domain-containing protein 22,
• Gene location: 13q14.3 (51584193: 51767708)     Exons: 15     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein that contains two WD domains and an FYVE zinc finger region. The function of this gene is unknown. An alternatively spliced transcript variant of this gene may exist. [provided by RefSeq, Jul 2008]
• OMIM: 187280

Protein Summary

• Protein general information: Q96P53  
  • Name: WD repeat and FYVE domain containing protein 2 (Propeller FYVE protein) (Prof) (WD40 and FYVE domain containing protein 2) (Zinc finger FYVE domain containing protein 22)
  • Length: 400  
  • Mass: 45154
• Sequence:

  MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMS
  FNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLG
  GYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIM
  WDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQ
  MWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFD
  ATRGWLLTSGTDKVIKLWDMTPVVS

• Structural information:
  • Interpro: IPR020472  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  IPR042234  IPR000306  IPR017455  IPR011011  IPR013083  
  • Prosite: PS00678 PS50082 PS50294 PS50178
  • STRING: ENSP00000298125
• Other Databases: GeneCards:  WDFY2  Malacards:  WDFY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0045600	positive regulation of fat cell differentiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq