• Gene id: 115817

Gene Summary

• Gene Symbol: DHRS1   Gene   UCSC   Ensembl
• Aliases: SDR19C1
• Gene name: dehydrogenase/reductase 1
• Alternate names: dehydrogenase/reductase SDR family member 1, dehydrogenase/reductase (SDR family) member 1, short chain dehydrogenase/reductase family 19C member 1,
• Gene location: 14q12 (24299779: 24290597)     Exons: 10     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, h
• OMIM: 114770

Protein Summary

• Protein general information: Q96LJ7  
  • Name: Dehydrogenase/reductase SDR family member 1 (EC 1.1. . ) (Short chain dehydrogenase/reductase family 19C member 1)
  • Length: 313  
  • Mass: 33909
  • Tissue specificity: Detected in heart and liver, and at low levels in skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLF
  EQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVIS
  SPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSS
  AETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLR
  VPKWIIALYTSKF

• Structural information:
  • Interpro: IPR036291  IPR002347  
  • PDB: 2QQ5
  • PDBsum: 2QQ5
  • STRING: ENSP00000288111
• Other Databases: GeneCards:  DHRS1  Malacards:  DHRS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881