• Gene id: 115761

Gene Summary

• Gene Symbol: ARL11   Gene   UCSC   Ensembl
• Aliases: ARLTS1
• Gene name: ADP ribosylation factor like GTPase 11
• Alternate names: ADP-ribosylation factor-like protein 11, ADP-ribosylation factor-like 11, ADP-ribosylation factor-like tumor suppressor gene 1, ADP-ribosylation factor-like tumor suppressor protein 1,
• Gene location: 13q14.2 (52726452: 52827335)     Exons: 16     NC_000001.11
• Gene summary(Entrez): This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancer
• OMIM: 609351

Protein Summary

• Protein general information: Q969Q4  
  • Name: ADP ribosylation factor like protein 11 (ADP ribosylation factor like tumor suppressor protein 1)
  • Length: 196  
  • Mass: 21391
  • Tissue specificity: Expressed in lung and leukocytes. {ECO
• Sequence:

  MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWK
  DYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWE
  LRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • STRING: ENSP00000282026
• Other Databases: GeneCards:  ARL11  Malacards:  ARL11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881