• Gene id: 115727

Gene Summary

• Gene Symbol: RASGRP4   Gene   UCSC   Ensembl
• Gene name: RAS guanyl releasing protein 4
• Alternate names: RAS guanyl-releasing protein 4, guanyl nucleotide releasing protein 4,
• Gene location: 19q13.2 (26787053: 26800658)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the Ras guanyl nucleotide-releasing protein (RasGRP) family of Ras guanine nucleotide exchange factors. It contains a Ras exchange motif, a diacylglycerol-binding domain, and two calcium-binding EF hands. Th
• OMIM: 607320

Protein Summary

• Protein general information: Q8TDF6  
  • Name: RAS guanyl releasing protein 4
  • Length: 673  
  • Mass: 74882
  • Tissue specificity: Expressed by mast cells and their progenitors (at protein level). Specifically expressed in mononuclear leukocytes. Highly expressed in myeloid cells compared to lymphoid cells. Also detected in heart, skeletal muscle, spleen, liver, p
• Sequence:

  MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDELLEKCIQSFDSAGSL
  CHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQICHLVRYWLMRHPEVMHQDPQLEEVIGRFW
  ATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDL
  RSYVLQGSVRGCPALEGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHS
  AISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLVSLHEAQPDRLPDGRLH
  LPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTEDEIYELSYAREPRCPKSLPPSPFNAPLVVEW
  APGVTPKPDRVTLGRHVEQLVESVFKNYDPEGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYL
  LRASAICSKLGLAFLHTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDA
  GPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS

• Structural information:
  • Protein Domains: (49..17-)
    (/note="N-terminal-Ras-GEF)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00135-)
    (201..43-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168-)
    (466..50-)
    (/note="EF-hand-)
    (/evidence="ECO:0000255|PROSITE-ProRul-)
  • Interpro: IPR020454  IPR002048  IPR002219  IPR008937  IPR000651   IPR023578  IPR001895  IPR036964  
  • Prosite: PS50222 PS50009 PS50212 PS00479 PS50081
  • CDD: cd00029 cd00155 cd06224
  • PDB: 6AXG
  • PDBsum: 6AXG
  • STRING: ENSP00000479844
• Other Databases: GeneCards:  RASGRP4  Malacards:  RASGRP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0008283	cell population proliferation	IDA	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0009991	response to extracellular stimulus	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0030099	myeloid cell differentiation	TAS	biological process
GO:0007202	activation of phospholipase C activity	NAS	biological process
GO:0019992	diacylglycerol binding	TAS	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0030742	GTP-dependent protein binding	NAS	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq