• Gene id: 115426

Gene Summary

• Gene Symbol: UHRF2   Gene   UCSC   Ensembl
• Aliases: NIRF, RNF107, TDRD23, URF2
• Gene name: ubiquitin like with PHD and ring finger domains 2
• Alternate names: E3 ubiquitin-protein ligase UHRF2, Np95-like ring finger protein, RING finger protein 107, RING-type E3 ubiquitin transferase UHRF2, np95/ICBP90-like RING finger protein, nuclear protein 97, nuclear zinc finger protein NP97, ubiquitin-like PHD and RING finger do,
• Gene location: 9p24.1 (6413147: 6507055)     Exons: 19     NC_000009.12
• Gene summary(Entrez): This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded prote
• OMIM: 615211

Protein Summary

• Protein general information: Q96PU4  
  • Name: E3 ubiquitin protein ligase UHRF2 (EC 2.3.2.27) (Np95/ICBP90 like RING finger protein) (Np95 like RING finger protein) (Nuclear protein 97) (Nuclear zinc finger protein Np97) (RING finger protein 107) (RING type E3 ubiquitin transferase UHRF2) (Ubiquitin
  • Length: 802  
  • Mass: 89985
• Sequence:

  MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLVRP
  DPDHLPGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHS
  VTRASDGQSRGKTPLKNGSSCKRTNGNIKHKSKENTNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMN
  VKDLRPRARTILKWNELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKELRVKIFLGGSEGTLNDCKII
  SVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLN
  PPLDKVPEEEYWYCPSCKTDSSEVVKAGERLKMSKKKAKMPSASTESRRDWGRGMACVGRTRECTIVPSNHYGPI
  PGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPS
  ADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSS
  HGFLVWRYLLRRDDVEPAPWTSEGIERSRRLCLRLQYPAGYPSDKEGKKPKGQSKKQPSGTTKRPISDDDCPSAS
  KVYKASDSAEAIEAFQLTPQQQHLIREDCQNQKLWDEVLSHLVEGPNFLKKLEQSFMCVCCQELVYQPVTTECFH
  NVCKDCLQRSFKAQVFSCPACRHDLGQNYIMIPNEILQTLLDLFFPGYSKGR

• Structural information:
  • Protein Domains: (1..7-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214-)
    (448..61-)
    (/note="YDG-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00358"-)
  • Interpro: IPR015947  IPR036987  IPR003105  IPR021991  IPR000626   IPR029071  IPR011011  IPR001965  IPR019787  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50053 PS51015 PS01359 PS50016 PS00518 PS50089
  • PDB: 1WY8 1Z6U 2E6S 3OLN 4PW5 4PW6 4PW7 4TVR 5YCO
  • PDBsum: 1WY8 1Z6U 2E6S 3OLN 4PW5 4PW6 4PW7 4TVR 5YCO
  • STRING: ENSP00000276893
• Other Databases: GeneCards:  UHRF2  Malacards:  UHRF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0030154	cell differentiation	IEP	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0005720	nuclear heterochromatin	IBA	cellular component
GO:0010216	maintenance of DNA methylation	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0071158	positive regulation of cell cycle arrest	IDA	biological process
GO:0042393	histone binding	ISS	molecular function
GO:0005720	nuclear heterochromatin	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042393	histone binding	IEA	molecular function
GO:0005720	nuclear heterochromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881