• Gene id: 115362

Gene Summary

• Gene Symbol: GBP5   Gene   UCSC   Ensembl
• Aliases: GBP-5
• Gene name: guanylate binding protein 5
• Alternate names: guanylate-binding protein 5, GBP-TA antigen, GTP-binding protein 5, guanine nucleotide-binding protein 5,
• Gene location: 1p22.2 (89272859: 89258949)     Exons: 12     NC_000001.11
• Gene summary(Entrez): This gene belongs to the TRAFAC class dynamin-like GTPase superfamily. The encoded protein acts as an activator of NLRP3 inflammasome assembly and has a role in innate immunity and inflammation. Alternative splicing results in multiple transcript variants
• OMIM: 611467

Protein Summary

• Protein general information: Q96PP8  
  • Name: Guanylate binding protein 5 (EC 3.6.5. ) (GBP TA antigen) (GTP binding protein 5) (GBP 5) (Guanine nucleotide binding protein 5)
  • Length: 586  
  • Mass: 66617
  • Tissue specificity: Expressed in peripheral blood monocytes (at protein level). {ECO
• Sequence:

  MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSVASTVQSHT
  KGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALALLLSSTFVYNTVNKIDQGAIDLLHNVTELTD
  LLKARNSPDLDRVEDPADSASFFPDLVWTLRDFCLGLEIDGQLVTPDEYLENSLRPKQGSDQRVQNFNLPRLCIQ
  KFFPKKKCFIFDLPAHQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTLPGGIMVNGSRLKNLVLTYVN
  AISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQELLDLHRTSEREAIEVFMKNSFKDVD
  QSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAVKQGIYSKPGGHNLFIQKTEELKAKYYREPR
  KGIQAEEVLQKYLKSKESVSHAILQTDQALTETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQ
  VRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL

• Structural information:
  • Protein Domains: (35..27-)
    (/note="GB1/RHD3-type-G")
  • Interpro: IPR030386  IPR037684  IPR003191  IPR036543  IPR015894   IPR027417  
  • Prosite: PS51715
  • CDD: cd16269
  • STRING: ENSP00000359488
• Other Databases: GeneCards:  GBP5  Malacards:  GBP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	IDA	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	ISS	biological process
GO:0072616	interleukin-18 secretion	ISS	biological process
GO:0050702	interleukin-1 beta secretion	IMP	biological process
GO:0045089	positive regulation of innate immune response	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0045089	positive regulation of innate immune response	IEA	biological process
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:0072616	interleukin-18 secretion	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0050702	interleukin-1 beta secretion	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0009617	response to bacterium	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0034067	protein localization to Golgi apparatus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0071346	cellular response to interferon-gamma	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R