• Gene id: 115286

Gene Summary

• Gene Symbol: SLC25A26   Gene   UCSC   Ensembl
• Aliases: COXPD28, SAMC
• Gene name: solute carrier family 25 member 26
• Alternate names: S-adenosylmethionine mitochondrial carrier protein, mitochondrial S-adenosylmethionine transporter, solute carrier family 25 (S-adenosylmethionine carrier), member 26, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 26,
• Gene location: 3p14.1 (66133609: 66380020)     Exons: 20     NC_000003.12
• Gene summary(Entrez): This gene is a member of the mitochondrial carrier family which includes nuclear-encoded transporters localized on the inner mitochondrial membranes. Members of the family transport important small molecules across the mitochondrial inner membrane. This p

Protein Summary

• Protein general information: Q70HW3  
  • Name: S adenosylmethionine mitochondrial carrier protein (Mitochondrial S adenosylmethionine transporter) (Solute carrier family 25 member 26)
  • Length: 274  
  • Mass: 29354
  • Tissue specificity: Widely expressed. Highly expressed in testis, with moderate expression in brain, heart, kidney, lung, skeletal muscle, pancreas, small intestine and liver, and low expression in spleen. {ECO
• Sequence:

  MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGSFPNAAAFFITYEYVK
  WFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGIQGLYRGYKSTVLR
  EIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLAKAGSSTADGNVLSVL
  HGVWRSQGLAGLFAGVFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP

• Structural information:
  • Interpro: IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000346955
• Other Databases: GeneCards:  SLC25A26  Malacards:  SLC25A26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000095	S-adenosyl-L-methionine transmembrane transporter activity	IBA	molecular function
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0000095	S-adenosyl-L-methionine transmembrane transporter activity	EXP	molecular function
GO:0000095	S-adenosyl-L-methionine transmembrane transporter activity	EXP	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:1901962	S-adenosyl-L-methionine transmembrane transport	IEA	biological process
GO:1901962	S-adenosyl-L-methionine transmembrane transport	IEA	biological process
GO:1901962	S-adenosyl-L-methionine transmembrane transport	IEA	biological process
GO:1901962	S-adenosyl-L-methionine transmembrane transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0000095	S-adenosyl-L-methionine transmembrane transporter activity	IMP	molecular function
GO:0015805	S-adenosyl-L-methionine transport	IMP	biological process

Diseases

Associated diseases	References
Combined oxidative phosphorylation deficiency	KEGG:H00891
Combined oxidative phosphorylation deficiency	KEGG:H00891
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq