• Gene id: 115201

Gene Summary

• Gene Symbol: ATG4A   Gene   UCSC   Ensembl
• Aliases: APG4A, AUTL2
• Gene name: autophagy related 4A cysteine peptidase
• Alternate names: cysteine protease ATG4A, APG4 autophagy 4 homolog A, ATG4 autophagy related 4 homolog A, AUT-like 2, cysteine endopeptidase, autophagin 2, autophagy-related cysteine endopeptidase 2, autophagy-related protein 4 homolog A, hAPG4A,
• Gene location: Xq22.3 (174682912: 174559573)     Exons: 14     NC_000002.12
• Gene summary(Entrez): Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, a
• OMIM: 300663

Protein Summary

• Protein general information: Q8WYN0  
  • Name: Cysteine protease ATG4A (EC 3.4.22. ) (AUT like 2 cysteine endopeptidase) (Autophagin 2) (Autophagy related cysteine endopeptidase 2) (Autophagy related protein 4 homolog A) (hAPG4A)
  • Length: 398  
  • Mass: 45378
  • Tissue specificity: Widely expressed, at a low level, and the highest expression is observed in skeletal muscle and brain. Also detected in fetal liver. {ECO
• Sequence:

  MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGW
  GCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNT
  VAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLL
  IVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF
  HCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGA
  EFIDSTEQLEEFDLEEDFEILSV

• Structural information:
  • Interpro: IPR033474  IPR038765  IPR005078  
  • PDB: 2FUY 2P82
  • PDBsum: 2FUY 2P82
  • STRING: ENSP00000361306
• Other Databases: GeneCards:  ATG4A  Malacards:  ATG4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IDA	molecular function
GO:0008234	cysteine-type peptidase activity	IDA	molecular function
GO:0008234	cysteine-type peptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)