• Gene id: 1152

Gene Summary

• Gene Symbol: CKB   Gene   UCSC   Ensembl
• Aliases: B-CK, BCK, CKBB, CPK-B, HEL-211, HEL-S-29
• Gene name: creatine kinase B
• Alternate names: creatine kinase B-type, brain creatine kinase, creatine kinase B chain, creatine kinase brain, creatine kinase brain-type, creatine phosphokinase B-type, epididymis luminal protein 211, epididymis secretory protein Li 29,
• Gene location: 14q32.33 (103522832: 103519666)     Exons: 7     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as
• OMIM: 190151

Protein Summary

• Protein general information: P12277  
  • Name: Creatine kinase B type (EC 2.7.3.2) (Brain creatine kinase) (B CK) (Creatine kinase B chain) (Creatine phosphokinase B type) (CPK B)
  • Length: 381  
  • Mass: 42644
• Sequence:

  MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCV
  AGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGE
  RRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTF
  LVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
  NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDD
  LMPAQK

• Structural information:
  • Protein Domains: (11..9-)
    N-terminal (/note="Phosphagen-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00842-)
    (125..36-)
    C-terminal (/note="Phosphagen-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00843"-)
  • Interpro: IPR000749  IPR022415  IPR022414  IPR022413  IPR036802   IPR014746  
  • Prosite: PS00112 PS51510 PS51509
  • PDB: 3B6R 3DRB 3DRE
  • PDBsum: 3B6R 3DRB 3DRE
  • DIP: 52968
  • STRING: ENSP00000299198
• Other Databases: GeneCards:  CKB  Malacards:  CKB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0021762	substantia nigra development	HEP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0004111	creatine kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016772	transferase activity, transferring phosphorus-containing groups	IEA	molecular function
GO:0046314	phosphocreatine biosynthetic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0046314	phosphocreatine biosynthetic process	IBA	biological process
GO:0016301	kinase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0004111	creatine kinase activity	IBA	molecular function
GO:0004111	creatine kinase activity	TAS	molecular function
GO:0004111	creatine kinase activity	IEA	molecular function
GO:0004111	creatine kinase activity	ISS	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006600	creatine metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030644	cellular chloride ion homeostasis	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0021549	cerebellum development	IEA	biological process
GO:0004111	creatine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00330	Arginine and proline metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq