• Gene id: 115123

Gene Summary

• Gene Symbol: MARCHF3   Gene   UCSC   Ensembl
• Aliases: MARCH-III, MARCH3, RNF173
• Gene name: membrane associated ring-CH-type finger 3
• Alternate names: E3 ubiquitin-protein ligase MARCHF3, E3 ubiquitin-protein ligase MARCH3, RING finger protein 173, RING-type E3 ubiquitin transferase MARCH3, RING-type E3 ubiquitin transferase MARCHF3, membrane associated ring finger 3, membrane-associated RING-CH protein III, m,
• Gene location: 5q23.2 (127032401: 126867713)     Exons: 10     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the membrane-associated RING-CH (MARCH) family. The encoded protein is an E3 ubiquitin-protein ligase that may be involved in regulation of the endosomal transport pathway. [provided by RefSeq, Mar 2013]
• OMIM: 613333

Protein Summary

• Protein general information: Q86UD3  
  • Name: E3 ubiquitin protein ligase MARCHF3 (EC 2.3.2.27) (Membrane associated RING finger protein 3) (Membrane associated RING CH protein III) (MARCH III) (RING finger protein 173) (RING type E3 ubiquitin transferase MARCHF3)
  • Length: 253  
  • Mass: 28504
• Sequence:

  MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPMCRICH
  EGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMV
  CFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILLI
  PKSVNVPSNQPSLLGLHSVKRNSKETVV

• Structural information:
  • Interpro: IPR011016  IPR013083  
  • Prosite: PS51292
  • STRING: ENSP00000309141
• Other Databases: GeneCards:  MARCHF3  Malacards:  MARCHF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005768	endosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881