• Gene id: 115111

Gene Summary

• Gene Symbol: SLC26A7   Gene   UCSC   Ensembl
• Aliases: SUT2
• Gene name: solute carrier family 26 member 7
• Alternate names: anion exchange transporter, solute carrier family 26 (anion exchanger), member 7, solute carrier family 6 member 7, sulfate anion transporter,
• Gene location: 8q21.3 (91209495: 91398154)     Exons: 22     NC_000008.11
• Gene summary(Entrez): This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in gene structure and protein length yet have markedly different tissue expression patterns. This gene has abundant and specific expression in the ki
• OMIM: 608479

Protein Summary

• Protein general information: Q8TE54  
  • Name: Anion exchange transporter (Solute carrier family 26 member 7)
  • Length: 656  
  • Mass: 72213
  • Tissue specificity: Expressed in tonsillar high endothelial venule endothelial cells (HEVEC), placenta and in testis, expressed in a subgroup of basal cells in the epididymal ducts. {ECO
• Sequence:

  MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQQVTQGLAFAVLSSVH
  PVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVPQNMQNLTTQSNTSVLGLSDFEMQRIHVAAA
  VSFLGGVIQVAMFVLQLGSATFVVTEPVISAMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKS
  VRLEALLLSLLSIVVLVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
  PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCIPSAAAMGRTAGLYST
  GAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGMLIQFRDLKKYWNVDKIDWGIWVSTYVFTIC
  FAANVGLLFGVVCTIAIVIGRFPRAMTVSIKNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMN
  MIQKENACNQPLDDISKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGR
  SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV

• Structural information:
  • Protein Domains: (492..64-)
    (/note="STAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00198"-)
  • Interpro: IPR011547  IPR001902  IPR030329  IPR002645  IPR036513  
  • Prosite: PS50801
  • STRING: ENSP00000309504
• Other Databases: GeneCards:  SLC26A7  Malacards:  SLC26A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015106	bicarbonate transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0019531	oxalate transmembrane transporter activity	IBA	molecular function
GO:0016323	basolateral plasma membrane	IBA	cellular component
GO:0015301	anion:anion antiporter activity	IBA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IBA	molecular function
GO:0015108	chloride transmembrane transporter activity	IBA	molecular function
GO:0006820	anion transport	IEA	biological process
GO:0008509	anion transmembrane transporter activity	IEA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IEA	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0001696	gastric acid secretion	IEA	biological process
GO:0008271	secondary active sulfate transmembrane transporter activity	IEA	molecular function
GO:0008272	sulfate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0015301	anion:anion antiporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0001696	gastric acid secretion	IEA	biological process
GO:0005254	chloride channel activity	IEA	molecular function
GO:0015106	bicarbonate transmembrane transporter activity	IEA	molecular function
GO:0015701	bicarbonate transport	IEA	biological process
GO:0005253	anion channel activity	IEA	molecular function
GO:0006820	anion transport	IEA	biological process
GO:0006821	chloride transport	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0008272	sulfate transport	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005254	chloride channel activity	IDA	molecular function
GO:0019532	oxalate transport	IDA	biological process
GO:0015116	sulfate transmembrane transporter activity	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0019531	oxalate transmembrane transporter activity	IDA	molecular function
GO:0006821	chloride transport	IDA	biological process
GO:0006820	anion transport	IDA	biological process
GO:0015701	bicarbonate transport	ISS	biological process
GO:0015106	bicarbonate transmembrane transporter activity	ISS	molecular function
GO:0016323	basolateral plasma membrane	IMP	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04971	Gastric acid secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R