• Gene id: 115024

Gene Summary

• Gene Symbol: NT5C3B   Gene   UCSC   Ensembl
• Aliases: NT5C3L, cN-IIIB
• Gene name: 5'-nucleotidase, cytosolic IIIB
• Alternate names: 7-methylguanosine phosphate-specific 5'-nucleotidase, 5'-nucleotidase, cytosolic III-like, 7-methylguanosine nucleotidase, N(7)-methylguanylate 5'-phosphatase, cN-III-like protein, cytosolic 5'-nucleotidase 3B, cytosolic 5'-nucleotidase III-like protein,
• Gene location: 17q21.2 (41836275: 41825056)     Exons: 10     NC_000017.11

Protein Summary

• Protein general information: Q969T7  
  • Name: 7 methylguanosine phosphate specific 5' nucleotidase (7 methylguanosine nucleotidase) (EC 3.1.3.91) (Cytosolic 5' nucleotidase 3B) (Cytosolic 5' nucleotidase III like protein) (cN III like protein) (EC 3.1.3.5) (N(7) methylguanylate 5' phosphatase)
  • Length: 300  
  • Mass: 34389
• Sequence:

  MAEEVSTLMKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSYNILDNSKIISEECRK
  ELTALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVRESNAMLREGYKTFFNTLYHNNI
  PLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFNEDGFLQGFKGQLIHTYNKNSSACENSGYFQQLEGKTNV
  ILLGDSIGDLTMADGVPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHILCQGVQLEMQGP

• Structural information:
  • Interpro: IPR036412  IPR023214  IPR006434  
  • CDD: cd07504
  • STRING: ENSP00000389948
• Other Databases: GeneCards:  NT5C3B  Malacards:  NT5C3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008253	5'-nucleotidase activity	IBA	NOT|molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0016791	phosphatase activity	IBA	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0008253	5'-nucleotidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00240	Pyrimidine metabolism
hsa00760	Nicotinate and nicotinamide metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray