• Gene id: 115019

Gene Summary

• Gene Symbol: SLC26A9   Gene   UCSC   Ensembl
• Gene name: solute carrier family 26 member 9
• Alternate names: solute carrier family 26 member 9, anion transporter/exchanger protein 9, anion transporter/exchanger-9, solute carrier family 26 (anion exchanger), member 9,
• Gene location: 1q32.1 (205943471: 205913047)     Exons: 21     NC_000001.11
• Gene summary(Entrez): This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.
• OMIM: 608481

Protein Summary

• Protein general information: Q7LBE3  
  • Name: Solute carrier family 26 member 9 (Anion transporter/exchanger protein 9)
  • Length: 791  
  • Mass: 86988
  • Tissue specificity: Predominantly expressed in lung at the luminal side of the bronchiolar and alveolar epithelium of lung. To a lower extent, also expressed in pancreas and prostate. {ECO
• Sequence:

  MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPKYKIKDYIIPDL
  LGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGVHQMVPGTFAVISILVGNICLQLAPESKFQV
  FNNATNESYVDTAAMEAERLHVSATLACLTAIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFG
  LTIPSYTGPGSIVFTFIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGG
  CKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHGYDVDSNQEMIALGCS
  NFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITMLVLGIYLYPLPKSVLGALIAVNLKNSLKQLT
  DPYYLWRKSKLDCCIWVVSFLSSFFLSLPYGVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQD
  IQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQ
  DFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFVTFHTLILDMSGVSFV
  DLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHDAVLFAQANARDVTPGHNF
  QGAPGDAELSLYDSEEDIRSYWDLEQEMFGSMFHAETLTAL

• Structural information:
  • Protein Domains: (519..73-)
    (/note="STAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00198"-)
  • Interpro: IPR011547  IPR001902  IPR030306  IPR002645  IPR036513  
  • Prosite: PS50801
  • STRING: ENSP00000356102
• Other Databases: GeneCards:  SLC26A9  Malacards:  SLC26A9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015106	bicarbonate transmembrane transporter activity	IBA	molecular function
GO:0015108	chloride transmembrane transporter activity	IBA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IBA	molecular function
GO:0015301	anion:anion antiporter activity	IBA	molecular function
GO:0019531	oxalate transmembrane transporter activity	IBA	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0015116	sulfate transmembrane transporter activity	IEA	molecular function
GO:0015301	anion:anion antiporter activity	IEA	molecular function
GO:0005254	chloride channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0008271	secondary active sulfate transmembrane transporter activity	IEA	molecular function
GO:0008272	sulfate transport	IEA	biological process
GO:0015701	bicarbonate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0019532	oxalate transport	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005254	chloride channel activity	IDA	molecular function
GO:0005254	chloride channel activity	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0015701	bicarbonate transport	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005254	chloride channel activity	IDA	molecular function
GO:0005254	chloride channel activity	IDA	molecular function
GO:0005254	chloride channel activity	IDA	molecular function
GO:0015301	anion:anion antiporter activity	IDA	molecular function
GO:0015301	anion:anion antiporter activity	IDA	molecular function
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0006821	chloride transport	IDA	biological process
GO:0006821	chloride transport	IDA	biological process
GO:0006821	chloride transport	IDA	biological process
GO:0006820	anion transport	IDA	biological process
GO:0006821	chloride transport	IDA	biological process
GO:0006821	chloride transport	IDA	biological process
GO:0006820	anion transport	IDA	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray