• Gene id: 114971

Gene Summary

• Gene Symbol: PTPMT1   Gene   UCSC   Ensembl
• Aliases: DUSP23, MOSP, PLIP, PNAS-129
• Gene name: protein tyrosine phosphatase mitochondrial 1
• Alternate names: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1, NB4 apoptosis/differentiation related protein, PTEN-like phosphatase, phosphoinositide lipid phosphatase,
• Gene location: 11p11.2 (47565429: 47573460)     Exons: 4     NC_000011.10
• OMIM: 609538

Protein Summary

• Protein general information: Q8WUK0  
  • Name: Phosphatidylglycerophosphatase and protein tyrosine phosphatase 1 (EC 3.1.3.27) (PTEN like phosphatase) (Phosphoinositide lipid phosphatase) (Protein tyrosine phosphatase mitochondrial 1) (EC 3.1.3.16) (EC 3.1.3.48)
  • Length: 201  
  • Mass: 22844
• Sequence:

  MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEY
  ETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQV
  HKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

• Structural information:
  • Protein Domains: (109..18-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR000340  IPR029021  IPR042165  IPR016130  IPR000387   IPR020422  
  • Prosite: PS00383 PS50056
  • STRING: ENSP00000325958
• Other Databases: GeneCards:  PTPMT1  Malacards:  PTPMT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IBA	molecular function
GO:0008962	phosphatidylglycerophosphatase activity	IBA	molecular function
GO:0032049	cardiolipin biosynthetic process	ISS	biological process
GO:0008962	phosphatidylglycerophosphatase activity	ISS	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0008962	phosphatidylglycerophosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0006655	phosphatidylglycerol biosynthetic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:2001242	regulation of intrinsic apoptotic signaling pathway	IGI	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)