• Gene id: 114907

Gene Summary

• Gene Symbol: FBXO32   Gene   UCSC   Ensembl
• Aliases: Fbx32, MAFbx
• Gene name: F-box protein 32
• Alternate names: F-box only protein 32, atrogin 1, muscle atrophy F-box protein,
• Gene location: 8q24.13 (123541205: 123497886)     Exons: 9     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
• OMIM: 606604

Protein Summary

• Protein general information: Q969P5  
  • Name: F box only protein 32 (Atrogin 1) (Muscle atrophy F box protein) (MAFbx)
  • Length: 355  
  • Mass: 41637
  • Tissue specificity: Specifically expressed in cardiac and skeletal muscle.
• Sequence:

  MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSKTKT
  QYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILE
  KVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTF
  TDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
  VRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

• Structural information:
  • Protein Domains: (223..27-)
    (/note="F-box"-)
  • Interpro: IPR036047  IPR040394  
  • STRING: ENSP00000428205
• Other Databases: GeneCards:  FBXO32  Malacards:  FBXO32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016567	protein ubiquitination	IDA	biological process
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0014894	response to denervation involved in regulation of muscle adaptation	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0014894	response to denervation involved in regulation of muscle adaptation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030018	Z disc	IEA	cellular component
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881