• Gene id: 114904

Gene Summary

• Gene Symbol: C1QTNF6   Gene   UCSC   Ensembl
• Aliases: CTFP6, CTRP6, ZACRP6
• Gene name: C1q and TNF related 6
• Alternate names: complement C1q tumor necrosis factor-related protein 6, C1q and tumor necrosis factor related protein 6, complement-c1q tumor necrosis factor-related protein 6,
• Gene location: 22q12.3 (37199422: 37180165)     Exons: 9     NC_000022.11
• OMIM: 614910

Protein Summary

• Protein general information: Q9BXI9  
  • Name: Complement C1q tumor necrosis factor related protein 6
  • Length: 278  
  • Mass: 30861
• Sequence:

  MQWLRVRESPGEATGHRVTMGTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAHVSSAS
  SSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGR
  KTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSE
  RSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD

• Structural information:
  • Protein Domains: (97..13-)
    (/note="Collagen-like-)
    (139..25-)
    (/note="C1q-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00368"-)
  • Interpro: IPR001073  IPR008160  IPR008983  
  • Prosite: PS50871
  • STRING: ENSP00000338812
• Other Databases: GeneCards:  C1QTNF6  Malacards:  C1QTNF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Type 1 diabetes mellitus	KEGG:H00408
Type 1 diabetes mellitus	KEGG:H00408
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)