• Gene id: 1149

Gene Summary

• Gene Symbol: CIDEA   Gene   UCSC   Ensembl
• Aliases: CIDE-A
• Gene name: cell death inducing DFFA like effector a
• Alternate names: cell death activator CIDE-A,
• Gene location: 18 (12254360: 12277594)     Exons: 6     NC_000018.10
• Gene summary(Entrez): This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher
• OMIM: 604440

Protein Summary

• Protein general information: O60543  
  • Name: Cell death activator CIDE A (Cell death inducing DFFA like effector A)
  • Length: 219  
  • Mass: 24687
  • Tissue specificity: Expressed in omental and subcutaneous adipose tissue (at protein level). {ECO
• Sequence:

  MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTL
  VLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKAT
  MYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG

• Structural information:
  • Protein Domains: (33..11-)
    (/note="CIDE-N-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00447"-)
  • Interpro: IPR032936  IPR003508  
  • Prosite: PS51135
  • PDB: 2EEL
  • PDBsum: 2EEL
  • STRING: ENSP00000320209
• Other Databases: GeneCards:  CIDEA  Malacards:  CIDEA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0019915	lipid storage	IEA	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0034389	lipid droplet organization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0050995	negative regulation of lipid catabolic process	IEA	biological process
GO:1900118	negative regulation of execution phase of apoptosis	IEA	biological process
GO:0001659	temperature homeostasis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005740	mitochondrial envelope	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008219	cell death	IEA	biological process
GO:0010890	positive regulation of sequestering of triglyceride	IEA	biological process
GO:0019915	lipid storage	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0035634	response to stilbenoid	IEA	biological process
GO:0070417	cellular response to cold	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:1902510	regulation of apoptotic DNA fragmentation	IEA	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0005811	lipid droplet	IDA	colocalizes with
GO:0032720	negative regulation of tumor necrosis factor production	IMP	biological process
GO:0050710	negative regulation of cytokine secretion	IMP	biological process
GO:0050995	negative regulation of lipid catabolic process	ISS	biological process
GO:0050995	negative regulation of lipid catabolic process	IMP	biological process
GO:1900118	negative regulation of execution phase of apoptosis	ISS	biological process
GO:0001659	temperature homeostasis	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005739	mitochondrion	ISS	cellular component
GO:0005740	mitochondrial envelope	ISS	cellular component
GO:0006629	lipid metabolic process	ISS	biological process
GO:0008219	cell death	ISS	biological process
GO:0010890	positive regulation of sequestering of triglyceride	ISS	biological process
GO:0019915	lipid storage	ISS	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:1902510	regulation of apoptotic DNA fragmentation	ISS	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process

Diseases

Associated diseases	References
obesity	PMID:16186410
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq