• Gene id: 114899

Gene Summary

• Gene Symbol: C1QTNF3   Gene   UCSC   Ensembl
• Aliases: C1ATNF3, CORCS, CORS, CORS-26, CORS26, CTRP3
• Gene name: C1q and TNF related 3
• Alternate names: complement C1q tumor necrosis factor-related protein 3, C1q and tumor necrosis factor related protein 3, cartonectin, collagenous repeat-containing sequence 26 kDa protein, collagenous repeat-containing sequence of 26-kDa, secretory protein CORS26,
• Gene location: 5p13.2 (4940091: 4945221)     Exons: 12     NC_000017.11
• OMIM: 612045

Protein Summary

• Protein general information: Q9BXJ4  
  • Name: Complement C1q tumor necrosis factor related protein 3 (Collagenous repeat containing sequence 26 kDa protein) (CORS26) (Secretory protein CORS26)
  • Length: 246  
  • Mass: 26994
  • Tissue specificity: Expressed in colon and small intestine. {ECO
• Sequence:

  MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNG
  ATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDV
  MTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNG
  ALHGDHQRFSTFAGFLLFETK

• Structural information:
  • Protein Domains: (51..11-)
    (/note="Collagen-like-)
    (113..24-)
    (/note="C1q-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00368"-)
  • Interpro: IPR001073  IPR008160  IPR008983  
  • Prosite: PS50871
  • STRING: ENSP00000371497
• Other Databases: GeneCards:  C1QTNF3  Malacards:  C1QTNF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0045721	negative regulation of gluconeogenesis	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:1900165	negative regulation of interleukin-6 secretion	IDA	biological process
GO:0071638	negative regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:0035356	cellular triglyceride homeostasis	IDA	biological process
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0070165	positive regulation of adiponectin secretion	IDA	biological process
GO:0050715	positive regulation of cytokine secretion	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045444	fat cell differentiation	IEP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray