• Gene id: 114791

Gene Summary

• Gene Symbol: TUBGCP5   Gene   UCSC   Ensembl
• Aliases: GCP5
• Gene name: tubulin gamma complex associated protein 5
• Alternate names: gamma-tubulin complex component 5, gamma-tubulin complex component GCP5,
• Gene location: 15q11.2 (23039672: 22983024)     Exons: 28     NC_000015.10
• OMIM: 609972

Protein Summary

• Protein general information: Q96RT8  
  • Name: Gamma tubulin complex component 5 (GCP 5)
  • Length: 1024  
  • Mass: 118321
  • Tissue specificity: Widely expressed, with highest levels in heart and skeletal muscle and moderate levels in brain. {ECO
• Sequence:

  MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIH
  SDLSKAASWKRLTEEFLNAPLPSIKEIKTDAHYSILSLLLCLSDSPSNSSYVETPRNKEVEKKDDFDWGKYLMED
  EEMDIGPYMDTPNWSEESEEENDQQPLSREDSGIQVDRTPLEEQDQNRKLDPCISWKDEPDDRSWLEHHVVHQYW
  TARPSQFPHSLHLHSNLAAVWDQHLYSSDPLYVPDDRVLVTETQVIRETLWLLSGVKKLFIFQLIDGKVTVRNNI
  IVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESMLPGSGSVPKKSTEAPFRTYQAFMWALYKYFISF
  KEELAEIEKCIINNDTTITLAIVVDKLAPRLSQLKVLHKVFSTGVAEVPPDTRNVVRASHLLNTLYKAILEYDNV
  GEASEQTVSLLFSLWVETVRPYLQTVDEWIVHGHLWDGAREFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEE
  KMSDNASASSGSDQGPSSRQHTMVSFLKPVLKQIIMAGKSMQLLKNLQCAESTTCQAGARDAERKSLYTLFLESV
  QSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSS
  ESVTCQTFELTLRSCLYPHIDKQYLDCCGNLMQTLKKDYRLVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKE
  TWQNVSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLPVHILDGLTLSYKVPWPVDIVISLECQKIYNQVF
  LLLLQIKWAKYSLDVLLFGELVSTAEKPRLKEGLIHEQDTVAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNY
  IMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNLALMFADGWQAGLGTW
  RMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSLMAGMEQS

• Structural information:
  • Interpro: IPR007259  IPR040457  IPR042241  IPR041470  
  • PDB: 6V69 6V6S
  • PDBsum: 6V69 6V6S
  • STRING: ENSP00000480316
• Other Databases: GeneCards:  TUBGCP5  Malacards:  TUBGCP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0000923	equatorial microtubule organizing center	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0008274	gamma-tubulin ring complex	IBA	cellular component
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0051321	meiotic cell cycle	IBA	biological process
GO:0051415	microtubule nucleation by interphase microtubule organizing center	IBA	biological process
GO:0000930	gamma-tubulin complex	IBA	cellular component
GO:0043015	gamma-tubulin binding	IBA	molecular function
GO:0051011	microtubule minus-end binding	IBA	contributes to
GO:0051225	spindle assembly	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0007020	microtubule nucleation	IEA	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0000922	spindle pole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0043015	gamma-tubulin binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0008274	gamma-tubulin ring complex	IDA	cellular component
GO:0007020	microtubule nucleation	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray