• Gene id: 114786

Gene Summary

• Gene Symbol: XKR4   Gene   UCSC   Ensembl
• Aliases: XRG4
• Gene name: XK related 4
• Alternate names: XK-related protein 4, X Kell blood group precursor-related family, member 4, X-linked Kx blood group related 4, XK, Kell blood group complex subunit-related family, member 4,
• Gene location: 8q12.1 (55102027: 55542053)     Exons: 3     NC_000008.11

Protein Summary

• Protein general information: Q5GH76  
  • Name: XK related protein 4
  • Length: 650  
  • Mass: 71501
• Sequence:

  MAAKSDGRLKMKKSSDVAFTPLQNSDHSGSVQGLAPGLPSGSGAEDEEAAGGGCCPDGGGCSRCCCCCAGSGGSA
  GSGGSGGVAGPGGGGAGSAALCLRLGREQRRYSLWDCLWILAAVAVYFADVGTDVWLAVDYYLRGQRWWFGLTLF
  FVVLGSLSVQVFSFRWFVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPSTPQRQASNASKSNIA
  AANSGSNSSGATRASGKHRSASCSFCIWLLQSLIHILQLGQIWRYFHTIYLGIRSRQSGENDRWRFYWKMVYEYA
  DVSMLHLLATFLESAPQLVLQLCIIVQTHSLQALQGFTAAASLVSLAWALASYQKALRDSRDDKKPISYMAVIIQ
  FCWHFFTIAARVITFALFASVFQLYFGIFIVLHWCIMTFWIVHCETEFCITKWEEIVFDMVVGIIYIFSWFNVKE
  GRTRCRLFIYYFVILLENTALSALWYLYKAPQIADAFAIPALCVVFSSFLTGVVFMLMYYAFFHPNGPRFGQSPS
  CACEDPAAAFTLPPDVATSTLRSISNNRSVVSDRDQKFAERDGCVPVFQVRPTAPSTPSSRPPRIEESVIKIDLF
  RNRYPAWERHVLDRSLRKAILAFECSPSPPRLQYKDDALIQERLEYETTL

• Structural information:
  • Interpro: IPR018629  
  • STRING: ENSP00000328326
• Other Databases: GeneCards:  XKR4  Malacards:  XKR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902742	apoptotic process involved in development	IBA	biological process
GO:0070782	phosphatidylserine exposure on apoptotic cell surface	IBA	biological process
GO:0043652	engulfment of apoptotic cell	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray